(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAB

AL009126.YDAB        Location/Qualifiers
FT   CDS_pept        469426..470937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /locus_tag="BSU_04170"
FT                   /old_locus_tag="BSU04170"
FT                   /product="putative acyl-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04170"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12224"
FT                   /db_xref="GOA:P96575"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="SubtiList:BG12050"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96575"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12224.2"
FT                   /translation="METLQHLILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAML
FT                   QKGIQKGDRVALLCKNGHPASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF
FT                   YGAEFKEILDEVLPELSSLCVTMETGTAYETSAEFEALFAGPDHLPETEMVSPDDTALL
FT                   MFTSGTTGNPKRCMITHGGIYRYVKKSNSSIARMKGLRFLACHPIYHTSALICIMLGTF
FT                   AETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWEKHQTDLSSLVILMTGG
FT                   TKVPSSLISRYLDIGIPLAHGYGSTEAWGISTWTPDMGMDKAASAGKPVAGVKVKVEDP
FT                   LTGEELPQGEIGEIVVHTPFLFKGYEDNPEATAKVLQNGWFRTGDSGYVDEDGFIFITG
FT                   RYKDVIIYGGDNVYPDQVEEVIQQIPGILETAVVGIPDPLYGEKPKAFIVKNGGQRITE
FT                   EDVIAFCKERLSAYKIPEVEFVNELPKNNLGKVKKDVLRNQAVHS"
     atggaaacat tacagcatct gattctgcat gacatgccga atagcgaaga aatagaggct        60
     gtaaaaagcg gagaccatac actgacatat aaaggttacc gtaaacggat taatcagctg       120
     gcgaatgcca tgcttcaaaa aggaattcaa aagggcgacc gtgttgcatt gctttgcaaa       180
     aacggccatc ccgcctcaac tgttatgttc gccgcacttg aaataggtgc tgttgtcgta       240
     cctgtcagct ggcagctgaa accatatgaa atgacaggca ttttaaaagc aagtgaacca       300
     aaagcgatgt tttacggagc ggagtttaaa gagatactgg atgaagttct tcctgaattg       360
     tcctcactgt gtgtaacaat ggaaacagga acagcttacg aaacatctgc tgaatttgaa       420
     gcgctgtttg caggtcctga tcatttgcca gagacggaaa tggtttcacc tgatgataca       480
     gcacttctga tgtttacatc tggaacaacg ggaaacccga aaagatgcat gattacacat       540
     ggcggcatat acagatacgt taaaaaatcc aacagctcaa tagcacgtat gaagggcctt       600
     cgttttctcg cgtgccatcc gatttatcat acgagtgcgc tcatttgcat catgcttgga       660
     acgtttgcag aaacaacatt tgtgtttaca aaggatcaag atcctgttca catgctgaag       720
     gtcattgaag aagagaagat tcagaccgtg atggctcttc ctgtgttcta cacgtatttg       780
     cttgaggcgt gggaaaagca ccaaactgac ttatcttcgc ttgttatttt aatgacaggc       840
     ggaacaaaag tgccgagcag cctaataagc cgctatcttg atattggcat tccgcttgcg       900
     catggctatg gaagtactga ggcttggggc atcagcacat ggacgcctga tatgggaatg       960
     gataaagcgg catctgcagg aaaacctgtg gcaggtgtta aagtcaaagt ggaagatcct      1020
     ctgaccggag aagaacttcc tcaaggagaa atcggcgaaa tcgttgttca tactccattc      1080
     ttatttaaag gctatgaaga caatcctgaa gcaacagcga aagtgctgca aaatggatgg      1140
     tttagaaccg gagattcagg atatgtagat gaagatggct ttattttcat cacgggacgc      1200
     tacaaggatg tcattattta cggaggcgat aacgtctatc ctgatcaggt tgaagaagtt      1260
     atccagcaga tcccgggaat ccttgaaacg gctgtggtcg gtattcctga cccgctttac      1320
     ggtgaaaaac cgaaagcttt tatcgtgaaa aatggcggcc agcgcatcac ggaagaggat      1380
     gtcatcgcat tttgtaaaga acgcctgtcc gcttacaaaa tacctgaagt tgaatttgtt      1440
     aacgaactgc cgaaaaacaa ccttggcaag gtgaaaaaag acgtcctgcg caatcaggct      1500
     gtacattcat aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page