(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAC

AL009126.YDAC        Location/Qualifiers
FT   CDS_pept        complement(470957..471502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaC"
FT                   /locus_tag="BSU_04180"
FT                   /old_locus_tag="BSU04180"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04180"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12225"
FT                   /db_xref="GOA:P96576"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="SubtiList:BG12051"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96576"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12225.1"
FT                   /translation="MIAGYIMAAENQTLNQWTINQLGITRGDSILEVGFGPGYCMQQML
FT                   KREKDVHLHGIDVSEAMLKLAARRVKPKGVRLIQGSIETFPLPASFYDKVISVNNYTIW
FT                   NDQTKGIKQIYRALKPGGKAAITMQPREADASPEKTKSFGRQMIADFKAAGFEDIDIQF
FT                   KNIKPELSVCATAKKPAT"
     atgattgccg ggtacatcat ggctgctgaa aatcaaacac tgaatcagtg gacaatcaat        60
     cagctgggta tcacgcgcgg ggacagcatt ttagaagtcg ggtttggccc gggatactgc       120
     atgcagcaga tgctgaaacg cgagaaggat gttcatcttc atgggattga tgtatcagag       180
     gccatgctga agctggccgc ccgcagagtg aaaccaaagg gcgtacgcct gatacaagga       240
     agcatcgaga catttcctct ccccgcctcg ttttatgata aagtgatttc cgttaacaac       300
     tacaccattt ggaatgacca aacaaaaggc ataaaacaga tttatcgggc attaaagcca       360
     ggcggcaaag cagccattac gatgcagccg cgggaagcgg atgccagtcc tgagaaaacc       420
     aaatcatttg gaagacagat gattgctgac tttaaagcag ccggcttcga agacattgat       480
     atacaattta agaacattaa gcctgagctt tccgtctgtg caactgcaaa gaagcccgcc       540
     acataa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page