(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAD

AL009126.YDAD        Location/Qualifiers
FT   CDS_pept        471709..472569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /locus_tag="BSU_04190"
FT                   /old_locus_tag="BSU04190"
FT                   /product="putative dehydrogenase"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10220166, 11948145,
FT                   15805528, 21520290, 28197687; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04190"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12226"
FT                   /db_xref="GOA:P80873"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG12052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80873"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12226.1"
FT                   /translation="MANYPKELPAQTQSRQPGIESEMNPSPVYEYEDYKGADKLKGKVA
FT                   LITGGDSGIGRAVSVAYAKEGADIAIVYKDEHEDAEETKKRVEQEGVKCLLIAGDVGEE
FT                   EFCNEAVEKTVKELGGLDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKA
FT                   IDYLKPGSAIINTTSINPYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPG
FT                   PIWTPLIPATFPEETVAQFGQDTPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHVNGG
FT                   NFVTT"
     atggcaaatt atccaaaaga actgccggca caaactcaaa gtcgccagcc gggaattgaa        60
     agcgaaatga atccaagtcc ggtgtatgag tacgaggatt ataaaggagc agacaaatta       120
     aaaggaaaag tagctcttat tacaggcggc gacagcggga tcggacgcgc ggtttccgtc       180
     gcttacgcaa aggaaggcgc agacatcgcc attgtgtata aggatgagca tgaagacgct       240
     gaggagacga agaaacgtgt tgaacaagaa ggcgtaaaat gcctgctgat tgctggtgac       300
     gtaggtgaag aggaattctg caatgaagcg gttgaaaaaa cggtcaagga actaggcggc       360
     cttgacatcc ttgtcaacaa tgcaggtgaa cagcacccga aggaaagcat caaagatatt       420
     acgagcgaac agcttcaccg cacattcaaa acaaattttt attctcaatt ttatttgact       480
     aaaaaagcaa ttgattacct gaaaccgggc agcgccatca tcaatacgac atccatcaac       540
     ccgtacgtag ggaacccgac actgattgat tatacagcga caaaaggggc gatcaatgcc       600
     tttacaagaa caatggcgca ggcgcttgtc aaagacggca tccgtgtaaa tgcagtcgcg       660
     ccgggtccaa tttggacgcc actaatccca gctacgttcc ctgaagaaac agttgctcaa       720
     tttgggcaag atacgccgat gggccgtcct ggacagcctg ttgagcacgt cggctgttat       780
     gtgcttctgg catcagatga gtcctcttac atgacaggtc agaccctgca tgtcaacggc       840
     ggaaactttg tgacgacata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page