(data stored in ACNUC7421 zone)

EMBL: AL009126.YDAF

AL009126.YDAF        Location/Qualifiers
FT   CDS_pept        473174..473725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /locus_tag="BSU_04210"
FT                   /old_locus_tag="BSU04210"
FT                   /product="putative ribosomal protein N-acetyltransferase"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15468321; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12228"
FT                   /db_xref="GOA:P96579"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:1NSL"
FT                   /db_xref="SubtiList:BG12054"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96579"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12228.1"
FT                   /translation="MFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFAENPS
FT                   SADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEF
FT                   EGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVN
FT                   GMHHDLVYYSLLKREWEGEK"
     atgttcactt gcaaggtaaa tgagcacatc accatccgat tattggagcc gaaggatgcg        60
     gagcggctgg ccgaactcat tatccaaaat cagcagcggc ttggcaagtg gctgtttttt       120
     gcggaaaatc caagcagcgc tgacacgtac cgagaaacaa tcattccaga ttggcggcgc       180
     cagtatgccg acctgaacgg cattgaggcg ggtctccttt atgacggcag cctatgcggc       240
     atgatcagcc tgcataacct tgatcaagtg aatcgtaagg cggaaatcgg atattggatt       300
     gccaaagaat ttgaagggaa aggcattatt acagctgcct gccgaaaact cattacgtat       360
     gcttttgaag agcttgagct gaatcgtgtg gcgatctgtg cggctgtcgg aaacgaaaaa       420
     agcagagcgg ttccggagcg gatcgggttt ctagaggaag gaaaggcacg ggatggctta       480
     tacgtaaacg gcatgcatca cgacctcgtc tactacagtc tgttaaagcg tgaatgggaa       540
     ggcgaaaaat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page