(data stored in SCRATCH zone)

EMBL: AL009126.YDAL

AL009126.YDAL        Location/Qualifiers
FT   CDS_pept        480875..482584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaL"
FT                   /locus_tag="BSU_04290"
FT                   /old_locus_tag="BSU04290"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms; PubMedId: 27897378; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12236"
FT                   /db_xref="GOA:O31487"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="SubtiList:BG12059"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31487"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12236.1"
FT                   /translation="MLCVMMLLFSAIASFPVSAQAKDQDAGILIIYSTLDGKESSQVKM
FT                   LDLLAGHFTSHVTVKKDSDVEASDFKGKDHVIYYGQTKRKLSQKLLSLISGVKKPVVAI
FT                   GYNAGQISQFSGLSLARKENVFQVHSRSEKADVSLESGLNVLSVSGLKGTALYTFKADE
FT                   GTTHSFIWKTKKGNVYIGLTNLLNDNLIVAKQLREAFGEKAGTTLLYLRLEDISPMSDE
FT                   KLLLQAGTYLHKRHIPFILAVIPVYLNPETGDKVYLSNQPKMVKVLKKLQSMGGSIIVH
FT                   GYTHAYRYSETGEGFEFWDAKADQPITSGNAEDPPSILEKEQDFPNEQAYHSYLEPFRE
FT                   KEETYTKQKLTRAIEDLTSSGLYPLAFEAPHYTMSEYGYQIASQYFTSIFGQVQLSSTT
FT                   WKTSGAPPFVTAPSMLHGMTLYPETIGFVDTSKQNPLGEMEEHISQMIDFEGGVAGGFY
FT                   HPYLGMKYLPELVDQMERIPDSEWLDLKKTKQTVKTDKVEIHTSGDGTIQVKNGVSPIY
FT                   EFFDHHRQTPLEKALWILSAVVLLFVIMFVSYTFYLRATLKKRIFKERRSLG"
     ttgctatgcg tcatgatgct tctattttca gctattgcgt cttttcccgt ttctgcgcaa        60
     gcgaaagatc aggatgccgg cattctcatc atctactcaa ccttggacgg caaagagtcg       120
     tcacaagtca aaatgctcga tttgcttgcg ggccacttta catcccatgt gacagtcaaa       180
     aaagattcag acgttgaagc gtcggatttc aaagggaaag accatgtgat ttattacggc       240
     caaacgaaaa gaaagctcag ccaaaaattg ctgtctctta tcagcggcgt gaaaaaaccg       300
     gttgtcgcca ttggctataa cgcaggccaa atcagccaat tttctgggct ttcattagcc       360
     cgcaaagaaa atgtgtttca ggttcacagc aggtcagaaa aggccgatgt gtctctggaa       420
     agcgggctta acgtgctgag tgtatcaggc ctgaaaggaa cggcgcttta caccttcaaa       480
     gcggatgaag gcacaacgca ttcttttata tggaaaacaa aaaaagggaa tgtgtacatt       540
     ggattaacaa atttgttaaa tgacaatttg atcgtggcga aacagctcag agaagctttc       600
     ggagagaagg cggggacgac gttattgtat ttgcgtctcg aggatatcag cccgatgtct       660
     gatgaaaaac tgctgcttca agccggtaca tacctgcata agcggcatat tccttttatc       720
     ctggcggtca ttccggttta cttgaatccg gaaacaggcg acaaagtgta tttgtctaat       780
     caaccgaaga tggtcaaggt gctgaagaag ctgcaaagca tgggcggcag tatcatagtt       840
     cacggctata ctcacgctta tcgctacagt gaaacaggag agggatttga attttgggat       900
     gcaaaggcgg atcagccgat tacatccgga aatgccgaag accccccgtc cattttggag       960
     aaagaacagg acttcccgaa cgaacaagcc tatcacagct atcttgaacc atttcgggaa      1020
     aaggaagaaa cgtatacaaa acaaaaactg acgcgtgcca ttgaggattt gacatcatcg      1080
     ggtctttacc cgctggcgtt tgaagcgccg cattacacga tgtccgaata tggctatcaa      1140
     atcgcctcgc agtattttac aagcattttc ggccaggtcc agctcagcag cacaacatgg      1200
     aaaacatccg gtgcacctcc gtttgtgact gctccttcga tgctgcacgg aatgacgctt      1260
     tatccggaaa cgatcggctt tgtcgacaca tcgaagcaaa acccgctcgg tgagatggag      1320
     gagcatatct cccagatgat tgattttgaa ggcggagtag ccggaggatt ttatcacccg      1380
     taccttggga tgaaatatct gcctgagctg gttgatcaga tggaacgcat tccagacagt      1440
     gaatggcttg atttaaagaa aacgaaacaa accgtcaaaa cagacaaagt ggaaattcat      1500
     acaagcggtg acggaacgat tcaggtgaaa aacggcgtaa gccccattta cgagtttttc      1560
     gatcatcacc ggcaaacccc tctggaaaag gcgttatgga ttctctccgc tgttgtgctc      1620
     ttatttgtca tcatgtttgt cagttatacg ttttacttga gagccacatt gaaaaaacga      1680
     atttttaagg agagaagaag ccttgggtaa                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page