(data stored in SCRATCH zone)

EMBL: AL009126.YDAS

AL009126.YDAS        Location/Qualifiers
FT   CDS_pept        complement(492654..492911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /locus_tag="BSU_04370"
FT                   /old_locus_tag="BSU04370"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04370"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12244"
FT                   /db_xref="GOA:P96594"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="SubtiList:BG12066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96594"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12244.1"
FT                   /translation="MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGH
FT                   GLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA"
     atgcttagct ttttggtttc attagttgtt gcaattgtta tcggattaat tgggagcgcc        60
     attgtaggaa accggctgcc gggaggaatt ttcggctcta tgattgccgg gctgatcggc       120
     gcttggattg ggcacggact tcttggcaca tggggaccga gcctcgccgg ctttgctatt       180
     ttcccggcca tcatcggggc agccatcttc gtgttcttgc tgggccttat attccgcggg       240
     ctgcggaagg aagcctag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page