(data stored in SCRATCH zone)

EMBL: AL009126.YDBA

AL009126.YDBA        Location/Qualifiers
FT   CDS_pept        493559..494377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /locus_tag="BSU_04390"
FT                   /old_locus_tag="BSU04390"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04390"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12246"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="SubtiList:BG12068"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96596"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12246.1"
FT                   /translation="MPTERKEDLHQQLKEIEKWEKDQQKVWFWEKLSRLPFQLLDKLTP
FT                   EFIQKKIGKLLDEVGSFVQTGGQYLTSEKQIIRMFQKKLPEEIFESLEDIRKAPLPVMD
FT                   EIAEGMGKNRTNAATVQGATTGVGGVFTLAADIPAVLGLSLKTLQDIAVAYGYDPKEKK
FT                   ERVFIVKCLQLTSADVVGKRSILQELKHYDQDRTYKNVASQIQGWREVVLGYRDTFGWK
FT                   KLFQIVPVAGMVFGAAANRSTLNDITETGMMLYKKRRILERLKETEREME"
     gtgccaacag aacgaaaaga agacttacat cagcaattaa aagagataga gaaatgggaa        60
     aaagatcagc aaaaagtctg gttttgggaa aagctcagcc gtctcccgtt tcaactcctg       120
     gacaagctga caccagaatt catccagaaa aagatcggca agctcttgga tgaggtcggc       180
     agctttgttc aaacaggcgg acagtacctg acatctgaaa aacagattat caggatgttt       240
     caaaagaaac tgccggagga gatctttgaa tcgctggagg acatccggaa agcgcctctt       300
     cctgtcatgg atgaaattgc ggaaggaatg ggcaaaaaca gaaccaacgc agcaaccgtt       360
     caaggcgcga caaccggtgt gggcggcgtg tttacgctgg cggcagacat tccggcagtg       420
     cttggcttat cactaaaaac attacaggat atcgcagtcg catacggcta tgacccaaag       480
     gagaaaaaag aacgagtctt cattgtgaaa tgcctgcagc ttacgtcggc tgatgttgtc       540
     ggcaaaagat cgattttgca ggaattaaaa cactacgatc aagaccgtac atataagaat       600
     gtcgcttctc aaatccaagg ctggcgagaa gtcgttttgg gctatcgaga cacgtttggc       660
     tggaaaaaac ttttccagat agtgccggtt gccggaatgg tttttggcgc cgctgccaat       720
     cgctcaacat taaacgacat taccgagaca ggcatgatgc tgtacaaaaa gaggcgcatt       780
     cttgaacgac tgaaagaaac agaacgagag atggaatag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page