(data stored in ACNUC7421 zone)

EMBL: AL009126.YDBB

AL009126.YDBB        Location/Qualifiers
FT   CDS_pept        495009..495350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /locus_tag="BSU_04410"
FT                   /old_locus_tag="BSU04410"
FT                   /product="putative enzyme; cupin family"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10704478; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04410"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12248"
FT                   /db_xref="GOA:P96597"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR019780"
FT                   /db_xref="SubtiList:BG12069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96597"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12248.1"
FT                   /translation="MSKMQNLLAIANEVKEKHANFSISEVNDHCVRLAVFTGEYDWHHH
FT                   PDSDELFIVLEGELLIDFKDKETAVLKANDSLLIPKGTVHRTRSYVRTVNLCVEHKQAE
FT                   TVIIEEQPC"
     atgtccaaga tgcaaaactt gctcgccatc gcaaatgaag tcaaagaaaa gcacgccaat        60
     ttttcaatct cagaggtcaa cgaccactgc gtgcgccttg cggtgtttac gggagaatat       120
     gactggcacc atcaccctga ctcagacgaa ttgtttattg ttcttgaagg ggagctgctg       180
     atcgatttta aggacaaaga aaccgcggtg ctcaaagcaa atgacagcct gctgatccct       240
     aaaggcacgg ttcaccgcac acgctcttac gtcagaacgg taaatctctg tgtggagcat       300
     aaacaagccg aaaccgtcat catagaggag cagccatgct aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page