(data stored in ACNUC7421 zone)

EMBL: AL009126.YDBC

AL009126.YDBC        Location/Qualifiers
FT   CDS_pept        495344..495703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbC"
FT                   /locus_tag="BSU_04420"
FT                   /old_locus_tag="BSU04420"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4: Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04420"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12249"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="SubtiList:BG12070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96598"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12249.1"
FT                   /translation="MLIKKMICEVDAANAEAFAKAQSQWEALSHISGFIKQAGGWRKTI
FT                   DEPLTAEIISVWENREAYDHFMENEHDSIYEENDQKAVILSIEVTVYEEDKPFVHDLLH
FT                   NPDIRYEPNWTVLKA"
     atgctaatca aaaagatgat atgtgaagta gatgctgcaa acgctgaagc atttgcaaaa        60
     gcgcagtcac agtgggaagc gttatcgcat ataagcggct ttatcaaaca ggccggcggc       120
     tggcgaaaaa cgatagacga gccgctcacc gcagaaatca tcagtgtatg ggaaaacaga       180
     gaagcctatg atcattttat ggagaacgaa catgacagca tatacgagga aaacgatcag       240
     aaggctgtaa ttctttcgat agaggtgacg gtgtacgaag aggataaacc gttcgttcac       300
     gatctgttac ataaccccga tatccggtac gaaccaaact ggacggttct gaaggcataa       360
//

If you have problems or comments...

PBIL Back to PBIL home page