(data stored in SCRATCH zone)

EMBL: AL009126.YDBD

AL009126.YDBD        Location/Qualifiers
FT   CDS_pept        complement(495740..496561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /locus_tag="BSU_04430"
FT                   /old_locus_tag="BSU04430"
FT                   /product="putative manganese-containing catalase"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.11.1.6"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15231799; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12250"
FT                   /db_xref="GOA:P80878"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="SubtiList:BG12071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80878"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12250.1"
FT                   /translation="MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQ
FT                   GWNTRGNEKYKDLLMDTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGG
FT                   MNPHHAIVSGLGAMPESSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMT
FT                   DDKGVKDMLSFLLARDTMHQNQWLAAIKELEAQEGPVVPGTFPKALEKQEFSHQLINFS
FT                   EGEVSAEQNWLNEKAPDGEAFEYVKEAKTFGEKPELKPAPPFVHNTLPGRE"
     atgtttaagc acacaaaaat gctgcagcat cctgctaaac cagatcgtcc agatccatta        60
     ttcgctaaaa aaatgcaaga aattttaggc gggcaattcg gagaaatttc agttgccatg       120
     cagtacttat ttcaaggctg gaacacaaga ggaaatgaaa aatacaagga cttgctgatg       180
     gatacggcaa ctgaggagct cgggcatgtt gaaatgatcg caacgatgat tgccagactt       240
     cttgaggatg cccctcttga tcagcaggaa aaagctgctg aagatccggt catcggctcc       300
     atcctaggcg gcatgaaccc tcaccatgcg attgtatcag gacttggcgc catgccggaa       360
     agcagtacag gcgtaccttg gagcggcggt tatatcgtag caagcggaaa cctgctggca       420
     gacttccgcg ccaacctgaa tgcggaatct cagggccgtc tgcaggtcgc acgcctgttt       480
     gaaatgacgg atgacaaagg cgtcaaagat atgctcagct tcctgctggc gcgtgacacg       540
     atgcaccaga accaatggct cgccgccatt aaagaattag aagcacagga aggtccggtt       600
     gtgccgggta cattcccgaa agcgctcgaa aaacaagagt tctcacatca gcttatcaat       660
     ttctctgaag gcgaagtaag cgccgagcaa aactggctga atgaaaaagc gccggacgga       720
     gaagcctttg aatatgtgaa agaagcaaaa acgtttggag aaaaaccgga gttaaaacca       780
     gcaccgcctt ttgttcataa tacacttccg ggacgcgagt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page