(data stored in SCRATCH zone)

EMBL: AL009126.YDBI

AL009126.YDBI        Location/Qualifiers
FT   CDS_pept        501579..502631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbI"
FT                   /locus_tag="BSU_04480"
FT                   /old_locus_tag="BSU04480"
FT                   /product="putative integral inner membrane protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15849754, 16850406;
FT                   Product type m: membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04480"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12255"
FT                   /db_xref="GOA:P96604"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="SubtiList:BG12076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96604"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12255.1"
FT                   /translation="MAALVKFFQHPGVRRFSIFVVLTGVLYLFKSMINLILLTFIFTFL
FT                   MDRLELVVRQFVSQFFRVSQRVVITFLYMLLAVLLTVGGFVFYPVVAAQIQQLVKQIKH
FT                   IAYHPDSIPFFDEITSVFGDINISSYVKEGFNVVYTYLADISTFGLQVVMALILSMFFL
FT                   FEKKRLSEFMAKFKTSKLRVFYEEIAFFGSKFARTFGKVLEAQFIIALVNCILTFIALW
FT                   IMHFPQLFGLSIMVFFLGLIPVAGVVISLIPLSIIAYSTGGGMYVLYIVLVIFAIHAIE
FT                   TYFLNPKLMSAKTELPIFFTFTVLIFSEHFFGIWGLIIGIPIFVFLLDILDVTNKEDRS
FT                   KGPRENSDKK"
     atggccgctt tagttaaatt ttttcagcac ccgggagtaa ggcgtttctc catctttgtc        60
     gtgttaactg gtgtgttata tctatttaag agcatgatca acttaatatt gcttaccttc       120
     attttcacat ttctaatgga tcgtttggag cttgtcgtgc ggcagtttgt aagccagttc       180
     ttccgcgtga gccagcgggt tgtcattacg tttctttaca tgttgctggc tgtgctgctt       240
     acagtcgggg gctttgtgtt ttatccggtc gtcgcggcgc agatccagca gctggtaaag       300
     cagattaaac atattgcgta tcatcctgac agcatccctt tctttgatga gatcaccagt       360
     gtcttcggag atattaacat cagttcatat gtcaaagagg gcttcaatgt agtgtatacg       420
     tatctggccg atatcagcac attcggcttg caggtcgtga tggcgctcat tcttagcatg       480
     tttttcttat ttgagaaaaa acggctttct gaattcatgg cgaaatttaa aacgagcaaa       540
     cttagggtct tttatgagga gattgctttt ttcggaagca aatttgcaag aacgttcggc       600
     aaggtgctcg aggctcaatt tatcattgcg ctcgtcaact gtattctgac gtttatcgcg       660
     ctttggatta tgcattttcc gcagctgttt gggctttcga ttatggtgtt cttccttgga       720
     ttgatccctg tagcaggcgt cgtcatttcc ctgattccgc tcagcattat cgcctacagc       780
     actggcggtg gaatgtatgt gctctacatt gtccttgtca tattcgccat tcatgcgatc       840
     gaaacctatt tcttaaatcc gaagctgatg tcggcgaaaa cagagctgcc aatctttttc       900
     accttcacag tactcatttt ctctgaacac ttcttcggca tttggggttt aattatcggg       960
     attccgatct ttgtgtttct ccttgatatt ctggatgtca ccaacaagga agataggtct      1020
     aaaggacccc gagagaatag cgataaaaag tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page