(data stored in SCRATCH zone)

EMBL: AL009126.YDBK

AL009126.YDBK        Location/Qualifiers
FT   CDS_pept        503854..504594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbK"
FT                   /locus_tag="BSU_04500"
FT                   /old_locus_tag="BSU04500"
FT                   /product="putative efflux ABC-transporter (permease
FT                   subunit)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 12486040, 15849754,
FT                   16850406; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12257"
FT                   /db_xref="GOA:P96606"
FT                   /db_xref="SubtiList:BG12078"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96606"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12257.1"
FT                   /translation="MKLFNRKVTLVSLILMAVFQFFMALIIKRIVISAGTDENFIGYLS
FT                   YTPSLNILLQALTIVIAATIVSMEFDKKTIKFLLIRPVKRQKVFWSKLITVVMVSFYLY
FT                   LAYYILALLFGLLFFGTSVTAESKTLLVNTLALIGSNWLEAVMMGLFGLLCSSLFRNSA
FT                   VAVVVSFVVLYGASTLVQLMKLFENKWGSFLLFANTDFTQYRSGETALFSGMTPLFSIG
FT                   ILIIHAIFFIVVGWWCFCKRDVRV"
     atgaaacttt ttaatcggaa ggtcactttg gtttctctta tcctgatggc tgtctttcaa        60
     ttcttcatgg cattgatcat taaacggatt gtcatcagtg ccggaacaga tgaaaacttc       120
     atcggctatt tatcgtatac accgagcctg aacattttgc tgcaggcttt aacgatcgta       180
     attgcagcaa caattgtttc gatggaattt gataaaaaga cgatcaaatt tttgctcatt       240
     cgtccggtta aacgccaaaa ggtcttttgg tcaaaattaa tcacagtcgt gatggtcagc       300
     ttctatttgt atttggcata ctacattctg gcattattat tcggtctctt gttttttggc       360
     acatcggtga ctgcggaatc aaagacattg ctggtcaaca ccttggcgct gatcgggtca       420
     aactggcttg aagctgtaat gatgggatta ttcgggctgc tttgttcttc gctgttccgc       480
     aatagcgcgg tagcagttgt tgtttctttt gtcgttttat acggagcgag tacacttgtt       540
     cagctcatga agttgtttga aaacaagtgg ggcagctttt tgctttttgc gaacactgac       600
     tttacgcaat acagaagcgg agagacagcg ttgttttcag gcatgacgcc attgttttca       660
     attggaattc tcatcataca tgccatattc ttcatcgttg ttggctggtg gtgcttctgt       720
     aaacgggatg ttcgggtcta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page