(data stored in ACNUC7421 zone)

EMBL: AL009126.YDZK

AL009126.YDZK        Location/Qualifiers
FT   CDS_pept        complement(490777..491043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydzK"
FT                   /locus_tag="BSU_04359"
FT                   /old_locus_tag="BSU04359"
FT                   /product="putative membrane protein"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; Product type m: membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04359"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52551"
FT                   /db_xref="GOA:C0H3V4"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX52551.1"
FT                   /translation="MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSII
FT                   SLITAFTAGHTNFHVFIGGMFLFGTFLVGSAFPFFFGLKKKEK"
     atgtcagtat ttattctgtt ttatttgtgg attgttccta ttgttatcgg cattttatgt        60
     tctgttgctg cccataaatc caagggaaaa atgagagtcg cgcccggcat tgccatgatc       120
     gtgctcagta tcatttccct aatcacggcg tttacggccg gacacacaaa tttccacgtg       180
     tttatcggcg gcatgttttt attcggcacc ttcttggtcg gttctgcttt tcctttcttc       240
     ttcgggctga agaaaaaaga aaaataa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page