(data stored in ACNUC7421 zone)

EMBL: AL009126.ZNUC

AL009126.ZNUC        Location/Qualifiers
FT   CDS_pept        309347..310042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="BSU_02860"
FT                   /old_locus_tag="BSU02860"
FT                   /product="Zn(II) transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9379902, 9811636, 21813502;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12080"
FT                   /db_xref="GOA:O34946"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12764"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34946"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9379902, 9811636, 21813502"
FT                   /protein_id="CAB12080.1"
FT                   /translation="MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTL
FT                   IKVMLGMLKPWEGTVTISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKG
FT                   KWFKRLNEEDHLEVEKALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDE
FT                   PTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCL
FT                   TWNSCDELF"
     atgaatctcg tctcattgaa agatatcgtt ttcggctatt cccatacgcc tgttttagat        60
     aaagtatcac ttgatattga aagcggtgag ttcgtcggca tcactggacc aaacggcgcc       120
     tctaaatcga cgctcataaa ggtaatgctc ggcatgctga aaccgtggga aggcacagtg       180
     acgatcagta aaaggaatac agaagggaaa cgcctgacca tagggtacgt cccgcagcaa       240
     atttcttcat ttaatgccgg atttccgagc acggtgctgg agcttgttca gtcaggccgc       300
     tatacaaaag ggaaatggtt taaacgttta aatgaagaag atcatcttga agtagaaaaa       360
     gcattgaaaa tggtggaaat gtgggacctc cgccatcgta aaatcggtga tttatcaggc       420
     ggacagaaac agaaaatctg tatcgccaga atgctcgcca gcaacccgga tctgctgatg       480
     ctggacgaac cgacgacagc tgttgattac gacagcagaa aaggatttta cgaatttatg       540
     catcatctcg tgaaaaatca caaccgcaca gttgtgatgg ttactcacga acaaaacgaa       600
     gtacagcaat ttttagataa agtgattcga ttagagagag gagaaaaagg cggatggaaa       660
     tgtttgactt ggaattcatg cgacgagctt ttctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page