(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26310

AL161565.AT4G26310   Location/Qualifiers
FT   CDS_pept        complement(join(11284..11361,11487..11526,11704..11827,
FT                   12412..12481,12598..12648,12741..12754,12843..12873,
FT                   13014..13244))
FT                   /gene="AT4g26310"
FT                   /product="putative protein"
FT                   /note="similarity to elongation factor P (efp) RP238,
FT                   Rickettsia prowazekii, PIR2:B71678"
FT                   /note="Contains Elongation factor P signature
FT                   AA176-195;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA42-52"
FT                   /note="contains EST gb:F20046"
FT                   /db_xref="GOA:Q9STQ4"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ4"
FT                   /protein_id="CAB79486.1"
FT                   /translation="MRGLHHFKRISISRSLFSFSNATSPGAVTTRRSLYSLSRSLLSST
FT                   PYAAGGCCRETPPLHSPWSALQRRGVKVNAIQLRAGNVIERTGRTFRVVEAEHKQQGRG
FT                   GASIQVELRDVDTGNKLNLRFGSEESVEKEMKVQLQLYDGRALSASIPKHITCTVVETQ
FT                   LPMKGLTSAPRYKRALLDNGSTIQVPSYLEAGEKIVINTEDDSFVKRYY"
     atgagagggc tgcaccattt caagagaatc tcaatctctc gatctctctt ctccttctct        60
     aatgccactt ctcctggggc agtaacgact aggaggtctc tttattcttt gagcaggtcg       120
     ttgttgtcat caaccccgta cgccgccggt ggatgctgcc gagaaacgcc tccgcttcat       180
     tctccgtggt ctgctctgca acgccgcggt gttaaggtta acgcgattca gctaagggca       240
     ggaaatgtaa ttgagcgaac agggcgtact tttcgggttg tagaagcaga gcataagcaa       300
     caaggtagag gaggagcttc catacaggtt gagcttcgtg atgttgacac tgggaataag       360
     cttaacttgc gttttggatc tgaggagtcg gttgagaagg aaatgaaagt tcagttgcag       420
     ctgtatgatg gaagagcttt atctgcatct atccctaagc atatcacatg cacagttgta       480
     gaaacacaac ttccaatgaa aggcctaaca tcagctcctc ggtacaagag agctctcctg       540
     gataatggtt ccactattca ggtaccatct tatctcgagg caggtgaaaa gattgtgata       600
     aacactgagg atgactcttt tgttaagagg tattattaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page