(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26340

AL161565.AT4G26340   Location/Qualifiers
FT   CDS_pept        join(21308..22144,22450..22737)
FT                   /gene="AT4g26340"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q8H1R7"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8H1R7"
FT                   /protein_id="CAB79489.1"
FT                   /translation="MDRISQLSDDLLLQILSFIPGKDVVATSLLSKRWQSLWMLVSELE
FT                   YDDSYHTGDYKSFSQFVYRSLLSNNAPVIKHLHLNLGPDCPAIDIGLWIGFALTRRLRQ
FT                   LKINIRTSSNDASFSLPSSLYTSDTLETLRLINFVLLDVPSSVCLPSLKVLHLKTVDYE
FT                   DDASLPSLLFGCPNLEELFVERHDQDLEMDVTFVVPSLRRLSMIDKNYGQCDRYVIDVP
FT                   SLKYLNITDDAVYDVRQIENMPELVEAHVDITQGVTHKFLRALTSVRQLSLCLSLSEKQ
FT                   HESGLCGIETPIGWKLPSSVPECLLFSLEAFEWIGYKGRRGDREVATYVLKNAACLRTA
FT                   KFSPESTDVGEKYHMLKELASVPTASTSSKLLFD"
     atggaccgta ttagtcaact ttcggatgat ttgctcttgc aaatattgtc gtttattccg        60
     ggaaaagatg ttgtggccac aagtcttttg tccaaaaggt ggcagtctct ttggatgtta       120
     gtttcggaac ttgagtacga tgatagctac cacactggtg attataagag cttctctcag       180
     tttgtttaca ggtctttgct atcaaacaat gcacctgtta taaaacattt gcatctgaat       240
     cttggccctg actgtcccgc tatagatatt ggactatgga ttggttttgc tcttactcgc       300
     cgtctgcgcc agctgaaaat taatattcgt acttcttcca acgatgcgtc tttcagtttg       360
     ccgagtagcc tatatacctc tgatacatta gagaccttga gactcatcaa tttcgttcta       420
     ttggatgttc cttcttcagt ttgtctcccg tctctcaaag ttctacacct taagactgtt       480
     gattacgaag acgacgcatc tcttccaagt cttttatttg gttgtccaaa tcttgaagag       540
     ttgtttgtgg agcgacatga tcaagactta gaaatggatg tcactttcgt ggtgccttcc       600
     ttacgacggt tatccatgat cgacaaaaat tatggacaat gtgatcgata tgtgatagat       660
     gtcccttctt tgaagtacct taacattaca gatgacgcag tttacgacgt ccgtcaaatt       720
     gagaacatgc ctgagttggt cgaggcacat gttgacatta ctcaaggagt tactcacaag       780
     tttctgaggg ctcttacttc tgtccgacaa ctttctctat gtttatcact ctcagagaaa       840
     caacatgagt cgggtctttg tgggatagaa accccaattg gttggaagct gccgagttct       900
     gttcccgagt gtttgttgtt tagtctagag gcatttgagt ggattggata caaagggagg       960
     cgaggagata gagaggtggc aacatatgtc ctaaagaatg ctgcttgttt gaggacagca      1020
     aagttctctc cagagtctac tgatgtggga gagaagtatc atatgctcaa ggagttggca      1080
     tcagtaccta cagcttcaac ttcgtctaag cttctattcg actga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page