(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26350

AL161565.AT4G26350   Location/Qualifiers
FT   CDS_pept        join(24031..24897,24977..25111,25200..25493)
FT                   /gene="AT4g26350"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /db_xref="GOA:Q9STQ0"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ0"
FT                   /protein_id="CAB79490.1"
FT                   /translation="MDIISQCPDHLLLRILSFIPTKDVIVTSLLSKRWGSLWRWVPKLE
FT                   YDFTRQNMRFVKFVYRSLLQNNAPVLESLHLKNIILYAECRTVDIGGWIDIAVSRRVRE
FT                   LEISINCSDEKFRLPSSLYTCGTLESFILTIKHCHLVDVPLAVCLPSLKKLHLRCIGWA
FT                   YNATLLRLISGCTNLEELRLARPDDDGDYIMIHEAGSTIDYMSIFERRYMFEFMFDQMF
FT                   GKGSSNGINAPLKYFSISNNYRIHNFRGIEKMPDWVEARIAVTGGSHKYLKEITYAKGL
FT                   YVCLSVSEVMNPYDMIFHMLVDLTICTCTQGWWDLLTHMLQGSPKLRFLTLTNDHCREL
FT                   PSLETPACWKRPSSVPACLLSSLQAFTWSGYKGRQGDKEVVKYVLRNATGLKKRIFISK
FT                   SNDFGEKFCMLQELASVPTPSPSCQLLFDRIF"
     atggacatca tcagtcaatg tccggatcac ttgctcttgc gaatactgtc atttattccg        60
     acaaaagatg tcatcgtcac gagtcttttg tccaaaagat ggggatctct ttggagatgg       120
     gtgccaaaac ttgaatatga ttttacaaga caaaacatga gattcgtgaa gtttgtttac       180
     aggtctttgc tacagaataa cgctccagtt ctcgagagct tgcatctcaa gaatattatc       240
     ctttatgctg aatgtcgtac cgtagatatt ggaggatgga ttgatattgc agttagtcgg       300
     cgtgtgcgtg agctggaaat ttctattaat tgttcggatg aaaaattcag attgcctagt       360
     agcctatata catgtggaac gcttgagagc ttcatactca ccattaaaca ttgccatctt       420
     gtggatgttc ctttagcggt ctgtctccct tccctcaaaa aactacacct taggtgtatt       480
     ggttgggcat acaacgcaac tcttcttagg cttatatccg gttgcactaa tcttgaagag       540
     ttgcgtttag cacgacctga tgatgatggc gactatatta tgatacatga ggcaggcagt       600
     actatagatt atatgtccat ctttgaaaga aggtatatgt ttgagtttat gtttgatcaa       660
     atgtttggaa agggtagtag taatgggatc aatgctcctt tgaaatactt ttctatttct       720
     aataattatc gtatccacaa cttccgtggg attgagaaaa tgcctgactg ggtcgaggca       780
     cgtattgcgg ttactggtgg aagtcacaag tatctgaaag agattactta tgccaaaggc       840
     ctttatgtat gcttatcagt ctcagaggtt atgaatcctt acgacatgat cttccacatg       900
     cttgttgacc ttacgatatg tacatgtact caaggttggt gggatcttct tactcatatg       960
     ctccaaggtt cccccaaact acggtttctc acactcacca atgaccattg ccgagaactt      1020
     cctagtttag agaccccggc ctgctggaaa cggccgagtt ctgttcccgc gtgtttgttg      1080
     tccagtcttc aagctttcac gtggagtggg tataaaggga gacaaggaga taaagaagtg      1140
     gtaaaatatg tcctgaggaa tgctactggc ttgaagaaaa ggattttcat ttcaaaatca      1200
     aatgattttg gagagaagtt ttgtatgctc caggagttag catccgtacc aacgccttcg      1260
     ccatcatgtc agcttctgtt cgaccgaata ttttag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page