(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26360

AL161565.AT4G26360   Location/Qualifiers
FT   CDS_pept        complement(join(25941..26124,26238..26826,26859..28122,
FT                   28165..29553))
FT                   /gene="AT4g26360"
FT                   /product="putative protein"
FT                   /note="similarity to RNA-directed DNA polymerase,
FT                   Arabidopsis thaliana retrotransposon Ta11-1, PIR2:S65812"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA787-797"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:O65598"
FT                   /protein_id="CAB79491.1"
FT                   /translation="MSCGFNIPSHRNGFKKWFKVNRPIFGGVIEKHVKQPKDKKFINAL
FT                   LPGWFFDENYGFSDLGKIWVLWDPSVEVVIVAKSLQMITCEVLFPNSRTWIVISVVYAA
FT                   NEDDKRKELWREITALVASPVTFNRPWILLGDFNQVLHPHEHSRHVSLNVDRRIRDFRE
FT                   CLLDAELSDLVYKGSSFTWWNKSKTRPVAKKIDRILVNESWSNLFPSSFGLFGPPDFSD
FT                   HASCGVVLELDPIKAKRPFKFFNFLLKNPEFLNLVWDVWYSTNVVGSSMFRVSKKLKAL
FT                   KKPIKDFSRLNYSNLEKRTEEAHETLLSFQNLTLDNPSLENAAHELEAQRKWQILATAE
FT                   ESFFRQRSRVTWFAEGDGNTRYFHRMADSRKSVNTITTLVDDSGTQIDSQQGIADHCAL
FT                   YFENLLSDDNDPYSLEQDDMNLLLTYRCPYSQVADLEAMFSDEDIKAAFFGLPSNKACG
FT                   PDGFPVTAAVREFFISGNLLKQWNATTIVLIPKFPNASCTSDFRPISCMNTLYKVIARL
FT                   LTDRLQKLLSCVISPSQSAFLPGRLLAENVLLATEMVHGYNWRNISLRGMLKVDLRKAF
FT                   DSVRWEFIIAALLALGVPTKFINWIHQCISTPTFTVSVNGCCGGFFKSAKGLRQGDPLS
FT                   PYLFVLAMEVFSKLLNSRFDSGYIRYHPKASDLSISHLMFADDVMIFFDGGSSSLHGIC
FT                   ETLEDFASWSGLKVNNDKSHFFCAGLEQAERNSLAAYGFPQGCLPIRYLGLPLMCRKLR
FT                   IAEYEPLLEKSPKNSDHGQQIVYLTQVEFNLLLPLSMVSSTFGCPLSCCQRVALRRLKA
FT                   FVLGSFERETLMVVEEQRSLGLLFASQKMKVGLALEDSPSGTKRFVCVLFGFSLIIKVR
FT                   FGFLGTLITILEADPWSWRMLLFLRPLAEQFVKCNLGNGRIAHFWHDSWTSLGPLIKVM
FT                   GDYGSRSLRIPLNARVVEALGVNGWKLPLSRSAPAQAIHEHISTIMTPSPATIEDSFDW
FT                   VVGGVVCQGSLRQGLGMLLDQEHRNWTGQRLFGSRVLFLSMPSTCGLVSWIDSQLVKGL
FT                   PLGAISSLSIVAYALLRLSPETISFFPVNLRLRKVSAHAIIYNIWRQRNNVLHNNLRIA
FT                   PLIIFKIVDREIRNIISSRYHRKRWRNLMVLWIR"
     atgtcctgtg gttttaacat tcctagtcat cgtaacggct ttaaaaaatg gtttaaggtc        60
     aataggccta tttttggagg cgtcatagag aagcacgtga agcaaccaaa ggacaagaag       120
     tttattaatg ctctgctgcc tggttggttt tttgatgaga actatggttt ctcagattta       180
     gggaagatat gggtgttatg ggacccatct gttgaggttg ttattgttgc caaatcgttg       240
     cagatgatca cttgcgaggt tcttttccct aattctcgca cttggattgt tatctctgtg       300
     gtatatgcgg ccaacgaaga tgataagaga aaagagttat ggagagagat cactgctttg       360
     gtagcttctc cggtcacttt taatagacct tggatcttgc taggagattt taaccaggtt       420
     cttcatcctc atgagcactc taggcatgtt tcactcaatg tggataggag gataagagac       480
     tttagagaat gtttgttgga tgctgaactg tctgatcttg tttacaaagg cagctctttc       540
     acttggtgga ataaaagtaa aactagaccg gttgcaaaga agattgatcg catcttagtc       600
     aatgagagct ggtccaactt attcccatcc tcttttggtt tgtttggtcc gccagatttt       660
     tcagatcatg catcttgtgg tgttgtgctg gaattagacc cgatcaaagc gaagcggccc       720
     ttcaagttct ttaacttttt gttgaaaaac ccggagtttt taaatttggt gtgggatgtt       780
     tggtactcga ctaatgtggt gggatcgtct atgttccggg tgtcaaagaa gcttaaggct       840
     ctgaagaaac caatcaaaga ctttagtagg ctgaattatt caaaccttga aaaaagaact       900
     gaggaggctc atgagactct tttgagtttt caaaatctta ctcttgataa tccctccctg       960
     gaaaatgctg ctcatgaatt agaggctcaa cgtaaatggc agatccttgc cactgctgaa      1020
     gagagctttt ttcgtcaacg ttcccgagtg acttggtttg cggagggtga tggcaacaca      1080
     cgttattttc acagaatggc tgattccagg aaatctgtta acactatcac tactttggtg      1140
     gatgattcag ggacccaaat tgactcgcaa caaggcatcg ctgaccactg tgctctttat      1200
     tttgaaaatc tcctgagtga tgataacgac ccttattcgt tggagcaaga tgacatgaat      1260
     ttgctgctta cttacagatg tccctattct caggtggctg atttggaagc catgttctct      1320
     gatgaagata tcaaggctgc tttctttggt ctccctagta acaaagcttg tggcccggat      1380
     ggctttccgg tcaccgctgc tgtgagagaa ttttttattt cgggtaactt gcttaagcaa      1440
     tggaatgcaa ctaccattgt tctcattccc aagtttccta atgcctcttg tacttcagat      1500
     tttagaccta tctcttgcat gaataccctg tacaaagtca ttgctaggct tctcacagat      1560
     cgtcttcaga agctgctctc ttgtgttatc tctccttctc aatcagcttt tctccctgga      1620
     aggctcctcg ctgagaatgt cttgcttgcc actgagatgg ttcacggata caattggagg      1680
     aacatctctc tgagaggtat gttaaaggta gatcttcgaa aagcttttga ttcggtgcgt      1740
     tgggaattta tcattgcagc tttgcttgct cttggggtcc ctactaagtt cattaattgg      1800
     attcaccaat gcatttccac accaactttc actgtctctg taaatggttg ttgtggtggt      1860
     tttttcaaga gtgctaaagg gctgcgacag ggtgaccctc tttctcccta ccttttcgtt      1920
     cttgcaatgg aagtcttctc aaagttgctc aattctcggt ttgactcagg ttacattcgc      1980
     taccacccga aagcttctga tctctccatc tctcatttga tgttcgccga cgatgttatg      2040
     atattctttg atggtggtag ttcttccttg cacggtattt gtgagactct tgaggacttt      2100
     gcttcttggt ctggactaaa ggtgaacaac gacaaaagtc attttttttg tgctggtcta      2160
     gagcaggctg agagaaactc tttggcggcc tatggttttc cgcaaggctg cctccctatc      2220
     cggtatcttg ggcttccgct tatgtgtagg aagttgcgca tcgctgaata tgagcctctc      2280
     ctggaaaaat ctccaaaaaa ttcagatcat gggcaacaaa ttgtttatct tacgcaggta      2340
     gagttcaact tattgcttcc gttatctatg gtatcgtcaa cttttggatg tccactttct      2400
     tgctgccaaa gggttgcatt aagaagattg aaagcctttg tgctaggttc ctttgagcgg      2460
     gaaacattga tggtagtaga ggagcaaagg tctcttggtc tgctctttgc ctcccaaaaa      2520
     atgaaggtgg gcttggcctt agaagattct ccgagtggaa caaaacgctt tgtttgcgtc      2580
     ttatttggct tctctttaat catcaaggtt cgctttgggt ttcttggcac tctcatcacc      2640
     atcttagaag cagatccatg gtcttggcgt atgctcttgt tccttagacc tttggcggag      2700
     cagtttgtta aatgcaactt gggtaatggc cgcatagctc acttctggca tgacagttgg      2760
     acttcccttg gcccgctgat aaaggttatg ggtgattatg gctccagatc acttcgcatc      2820
     cctcttaacg ctagggtggt tgaggctctt ggtgttaatg gctggaagct ccccctatct      2880
     cggtctgctc cagctcaagc catccatgaa cacatctcta ccatcatgac cccctctcct      2940
     gctacaattg aagactcctt tgattgggtt gttggcggtg ttgtttgtca aggttctctt      3000
     cggcaaggac ttgggatgct attagaccaa gagcaccgga attggactgg gcaaaggctg      3060
     tttggttcaa gggtgctgtt cctaagcatg ccttcaacat gtggattagt cagttggata      3120
     gactcccaac tcgtcaaagg cttgcctctt ggggccatat ccagtctttc gattgttgct      3180
     tatgcactat tgagactgag tccagagacc atctcctttt ttcctgtgaa tttgcggctc      3240
     agaaaagtct cagcccatgc tatcatctac aacatttggc gtcagcgcaa caatgtcctc      3300
     cataacaatc ttaggatcgc acctcttatc atcttcaaga ttgtcgaccg cgagattcgt      3360
     aacatcatct cctctcgtta ccacagaaag agatggcgca acctcatggt gctttggatt      3420
     cgctaa                                                                 3426
//

If you have problems or comments...

PBIL Back to PBIL home page