(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26370

AL161565.AT4G26370   Location/Qualifiers
FT   CDS_pept        complement(join(31277..31414,31516..31614,31885..31972,
FT                   32065..32119,32257..32391,32557..32633,33018..33255,
FT                   33301..33331))
FT                   /gene="AT4g26370"
FT                   /product="putative protein"
FT                   /note="similarity to transcription termination factor nusB,
FT                   Synechocystis sp., PIR2:S76233"
FT                   /db_xref="GOA:O65597"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:O65597"
FT                   /protein_id="CAB79492.1"
FT                   /translation="MEGTFSPLCLHSHRSIGFTLVDSLRPTNLVSLRTGNKRSSSSSLR
FT                   LFLSPTRSALRTPTISAEEVKDVPMPKIDKSGRLSSPRAARELALVILYAACLEGSDPI
FT                   RLFEKRINARREPGYEFDKSSLLEYNHMSFGGPPVKTETKEEEDELVRHDEKESKIEAE
FT                   VLSAPPKLVYSKLVLRFAKKLLAAVVDKWDSHVVIIEKISPPDWKSAPAGRILEFSILH
FT                   LAMSEVAVLETRHPIVINEAVDLAKRFCDGSAPRIINGCLRTFVKDRATTSTPQALELK
FT                   QEVSV"
     atggagggaa ccttctcgcc gctttgctta cattctcacc gttctatagg atttacattg        60
     gttgattcgc tccggccaac gaacttggtt tccctgcgaa cgggaaataa acgttcgtca       120
     tcgtcttcac tacggctatt tctctctccg actagaagcg ctctccgtac gccgactatt       180
     tccgcggagg aggtgaaaga tgtcccgatg ccgaagattg ataagagcgg ccgattaagc       240
     agtcctcgag ccgcacgcga gctcgctctt gtaatacttt atgccgcatg cttagaaggc       300
     tctgacccaa ttcgtctctt tgagaagaga ataaacgcaa gaagagagcc tggatacgag       360
     tttgacaaga gttctttgtt ggaatacaac cacatgagct ttggaggacc cccagttaaa       420
     acagaaacaa aagaagaaga agatgagctt gtgcgccatg atgaaaaaga atcgaaaatc       480
     gaagccgaag tgctttcagc tcccccaaag ctggtgtaca gcaaacttgt tttacggttt       540
     gcaaagaaac tcttggctgc ggtagttgat aaatgggata gtcatgtcgt tatcatcgag       600
     aaaatttccc cgccagattg gaagagtgca ccagctggaa gaatattgga gttttcgatt       660
     cttcacttgg caatgtctga agtggcagtc cttgaaaccc gacacccgat tgtcattaac       720
     gaggctgttg atcttgcaaa acggttctgc gatggatcag caccacgcat aatcaacgga       780
     tgcctaagga catttgtcaa ggatagagca acaacatcaa cacctcaagc tttagaattg       840
     aagcaagaag tgtcggttta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page