(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26380

AL161565.AT4G26380   Location/Qualifiers
FT   CDS_pept        join(35256..38212,38645..38738)
FT                   /gene="AT4g26380"
FT                   /product="hypothetical protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AA651112"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004146"
FT                   /db_xref="UniProtKB/TrEMBL:O65596"
FT                   /protein_id="CAB79493.1"
FT                   /translation="MDSESELMISLISQLLSILGGGEDTHTPQLKSKLIALTCQLISLV
FT                   NSLDLDSQPEPESKLKSLIKQIIYVSNSVSEPGPESQSVSVVTKMISIIGSIDFDLKES
FT                   EPELMSLTSQIFALIMAMDEESELFSLLSEVASLVQTEEQKLINNQQVPPLTTEEEEKD
FT                   DLIYGYTDDMNWESELMFYIISKMISTLRGEDMCQEVARDFIAYANQLIPLIESLDMDS
FT                   NSEPKQEPKITSLVRQIISLSKVVSGPESQLVSLVTRIISITSSTDLDPTESQWRLTSV
FT                   TYKISRILKEIKDSEDSEMASLINQIHDLVDAEEGRKPESRLISSITQLMSHINSWSFY
FT                   SGMDPKIISLIIRIIYLVRSMDLDSQTKPKSELMSLVTQTIAVYNSMDLDSQPRPLRKV
FT                   VSVFSQYGFDVNSTVSDSESDSSENYVSHIKDSLKLEPEPELISFIHRIGSLVISMNPN
FT                   WEKLISFCPQFEVILSDDGKFQVEEGRLSKNQLSDDIPMKWNCLQVNWNLLKLHAGEKD
FT                   FTHFRCRGCNGDNHKENEKAPLEVKHPLHPKHPLQLVLSQSSGGRTRECYCCDEDLLHI
FT                   FYCCLACNFSMNVACTKKPAVLYRNHPRWHEHTLALFPRQASLTCNLCALADSSSPIYM
FT                   CPPCDFVVHLRCTGLPRVIKISRHLHRISFTFSFDRGDLSCSVCRRKIDEDYGGYTCIK
FT                   DGCSYAAHSKCATQKNVWDGIELEGEPEEVEEEVVDPFVTISDGVIQHFGHPQHHLRLD
FT                   ENTSRDYDEDKLCQACVMPIYFGNFYSCTQCNYILHEACANFSRKMHHPVHPHVLTLVN
FT                   SDGAINVRKECAACPWMCTTGFFYECSKEDFQLHVQCANLSEPLVHESHMHPLFLTSKP
FT                   GERRLCSACKESYFSVTRETFNCIECDFALCFRCATLPQKVRYKHDKHMLTLSYGEETS
FT                   TMTYWCEVCERNLNPKERFYKCDEYCSITLHIECMLGVALYIRPGSSWICFNNKKILIK
FT                   MKAKKVAYTGIEPVTFALLARRSNQLS"
     atggattccg agtcggagct catgatatct cttatttctc aactgttatc tatcttaggc        60
     ggtggggaag acacacatac accacagctg aagtcaaagt tgatagcact tacttgtcaa       120
     ctaatctctc tggtcaactc tctggatttg gattcgcagc cggagccgga gtcgaagctc       180
     aaatcactaa ttaagcagat aatttatgtc agcaactctg tttcagaacc aggaccagag       240
     tcgcagtcgg tatcagtggt gactaaaatg atctctatca tcggctctat agattttgat       300
     ctcaaggagt cagagccgga gctcatgtca ctcacttctc aaatattcgc tctcatcatg       360
     gcaatggacg aggaatcgga gctcttttca ctcctttctg aggtggccag tctcgtccag       420
     acggaggaac agaagctcat caataaccaa caagtgccgc ctctcaccac cgaagaagaa       480
     gaaaaagatg atcttatcta cggctataca gatgatatga attgggagtc ggagctcatg       540
     ttctatatca tttctaaaat gatatctaca ttaagaggtg aggatatgtg tcaagaggtg       600
     gcaagagatt tcatagcata cgctaatcaa cttattcctc tcatcgaatc actggatatg       660
     gattcgaatt cagagccgaa gcaggagccg aagatcacat cactcgttag gcaaataatc       720
     tctctcagca aggttgtttc tggaccagag tcacagttgg tatcactcgt gactcgaatt       780
     atctctatca ccagctctac agacttggat cccacggagt cacaatggag gctcacgtca       840
     gtcacttata aaatatctcg tatcctcaag gaaataaagg attcggagga ttcggagatg       900
     gcatcactca ttaatcaaat acacgacctc gttgacgcag aggagggacg aaagccagag       960
     tcaaggctca tatcaagcat cactcaacta atgtctcaca tcaactcttg gagtttttat      1020
     tcaggaatgg accccaagat catatctctc attattcgaa tcatctatct ggtcagatca      1080
     atggatttgg attcgcagac aaagcccaag tcggagctaa tgtcactcgt tactcaaact      1140
     atcgctgtct acaactctat ggatttggat tctcagccgc ggccgctaag gaaggtcgta      1200
     tcagtttttt ctcagtatgg ttttgacgta aattctacag tttcggattc agaatcggat      1260
     tcaagtgaga attacgtgtc acacattaaa gattcattaa aacttgagcc ggagcccgag      1320
     cttatttcct tcatccatcg aataggctcc ctcgtcatct ctatgaatcc aaactgggag      1380
     aagcttattt ccttttgccc tcaatttgaa gtaatactga gcgatgatgg aaagtttcaa      1440
     gtggaagaag gacgtctaag caaaaatcag ttatccgacg atatcccaat gaagtggaat      1500
     tgtctccagg taaactggaa tttattgaag ttacatgcag gagaaaaaga ctttactcat      1560
     tttcgctgtc gaggttgcaa tggtgacaac cataaagaaa atgaaaaggc tccacttgaa      1620
     gtcaaacacc ctcttcatcc taaacatcct cttcagcttg ttttgtcgca atcttctggt      1680
     ggtagaacga gggaatgcta ttgttgtgat gaagatttgc tgcatatatt ctattgttgc      1740
     ttggcttgca atttttctat gaatgtagct tgtactaaga agccagctgt cttatataga      1800
     aaccatccga ggtggcacga gcatacactt gctctgtttc caaggcaggc ttccttaact      1860
     tgcaaccttt gtgccttggc cgattcaagc tccccgatct atatgtgtcc cccttgcgac      1920
     tttgtcgtcc atcttagatg taccggctta ccacgtgtca taaagatatc ccgccatctc      1980
     caccgtatat catttacatt ttcttttgac cgaggagatt tgtcttgtag tgtttgtcgc      2040
     agaaaaatag acgaagatta cgggggctat acttgcatca aggacggctg ttcgtatgcg      2100
     gctcattcga aatgtgcaac acaaaaaaat gtgtgggatg gcatcgaact tgagggagag      2160
     cctgaagaag ttgaagaaga agtagttgac ccgtttgtga caataagcga cggagtcata      2220
     caacatttcg gtcacccaca acatcatttg agacttgacg agaacacgag cagagattac      2280
     gacgaggata agttgtgtca agcttgcgtc atgccaatct attttggtaa cttctactcc      2340
     tgtacgcaat gcaattatat actccacgaa gcatgtgcca atttctctcg caaaatgcat      2400
     catccggtac atccacatgt gctcacttta gtgaactctg acggtgctat caacgttaga      2460
     aaagaatgtg cagcttgtcc ttggatgtgc acaactggtt tcttctatga atgcagtaaa      2520
     gaagattttc agctacatgt gcagtgcgcc aacctgtctg agccactagt ccatgaaagt      2580
     catatgcatc ctttattcct aacatccaaa ccaggagaga ggagattatg ttccgcttgc      2640
     aaagagtcgt attttagtgt gacaagagaa acattcaact gcatagagtg tgattttgct      2700
     ttgtgcttta gatgtgctac tttacctcaa aaggtgaggt ataagcacga caaacatatg      2760
     ctcactcttt cgtatgggga agaaacaagt accatgacat attggtgtga agtttgcgag      2820
     agaaatttaa atccaaagga gcgattttat aagtgtgatg agtactgctc tatcacgcta      2880
     cacattgaat gtatgttggg ggtggcttta tacatcaggc ctggttcatc gtggatctgc      2940
     ttcaacaata aaaagatttt gatcaaaatg aaagccaaaa aagtggccta tacagggatc      3000
     gaacctgtga ccttcgcgtt attagcacga cgctctaacc aactgagcta a               3051
//

If you have problems or comments...

PBIL Back to PBIL home page