(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26390

AL161565.AT4G26390   Location/Qualifiers
FT   CDS_pept        join(39385..39603,40235..40696,40784..41596)
FT                   /gene="AT4g26390"
FT                   /product="pyruvate kinase like protein"
FT                   /note="strong similarity to pyruvate kinase, Nicotiana
FT                   tabacum, PIR2:S41379"
FT                   /note="Contains Pyruvate kinase active site signature
FT                   AA222-234"
FT                   /note="contains EST gb:T46063, AA713162, T76023, AA404815,
FT                   AB015097, F20011, AA042524"
FT                   /db_xref="GOA:O65595"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65595"
FT                   /protein_id="CAB79494.1"
FT                   /translation="MAMEQRPKTKIVCTLGPASRSVPMVEKLLMAGMSVARFNFSHGSY
FT                   EYHQETLDNLRQAMLNTGMLCAVMLDTKGPEIRTGFLKDGKPIQLKQGQEITISTDYDL
FT                   KGDEKTICMSYKKLAQDVNPGMVILCADGTISLKVLSCDKEKGTVRCRCENTSMLGERK
FT                   NVNLPGVVVDLPTLTEKDKQDILEWGVPNQIDMIALSFVRKGSDLVQVRKLLGKHAKTI
FT                   LLMSKVENQEGVANFDDILINSDAFMIARGDLGMEIPIEKIFLAQKVMIYKCNFMGKPV
FT                   VTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETAAGAYPELAVRTMAKICV
FT                   EAESTLDYGDIFKRIMLHAAVPMSPMESLASSAVRTATSSRATLMMVLTRGGSTARLVA
FT                   KYRPGIPILSVVVPEITSDSFDWACSNEAPARHSLIYRGLVPVLYAGSARASIDESTEE
FT                   TLEFASEYGKKKQLCKTGDSVVALFRTGNAIVIKILTVK"
     atggctatgg aacagaggcc taagacgaag atcgtgtgca cactcgggcc ggcgtccaga        60
     tctgtcccaa tggtcgagaa gcttcttatg gcggggatga gcgtggctcg cttcaacttt       120
     tctcatggat cttacgaata tcaccaggag actctcgaca atcttcgtca ggccatgctt       180
     aacactggca tgctatgtgc tgtcatgctc gacaccaagg gaccagagat tcgaaccggg       240
     ttcttaaagg atgggaaacc tatccagctc aaacaaggcc aagaaatcac catttcaact       300
     gactatgact tgaagggtga tgagaaaact atttgcatga gctacaagaa gttggcgcaa       360
     gatgtgaatc caggcatggt catactctgt gccgatggta ccatctcgtt aaaggtcctt       420
     tcttgtgaca aagaaaaggg cactgtccgt tgtcgttgtg agaacacttc aatgcttggt       480
     gaaagaaaga acgttaatct ccctggtgtt gtggttgatc tcccaactct aactgaaaaa       540
     gacaagcaag acattcttga atggggagtt cccaatcaaa tcgacatgat tgctctgtct       600
     tttgtcagaa aaggttcgga cttggtacaa gttaggaagc tacttggaaa acatgctaaa       660
     accatacttc tcatgtcaaa ggttgaaaac caagaaggtg tagcgaattt tgatgatatc       720
     ttgataaact cggatgcgtt tatgatcgca agaggtgacc ttggaatgga gattccaatt       780
     gagaagatat tcttagctca gaaagtgatg atctacaagt gcaatttcat ggggaagcca       840
     gtggttacag cgactcagat gcttgagtct atgatcaaat ccccacgacc aacaagagca       900
     gaagctactg atgttgcaaa tgctgtcctc gatggcacag actgtgtcat gcttagtggt       960
     gaaaccgcag ctggagcata cccagagctt gctgttcgta caatggccaa gatatgtgtg      1020
     gaagcagaga gcacacttga ctatggagac atcttcaaga ggataatgct tcacgctgcg      1080
     gtccctatga gcccgatgga gtcacttgct tcatctgcgg tcagaaccgc tacttcctca      1140
     agagccactc ttatgatggt cttgaccaga ggaggcagca cggcgaggct ggtggctaag      1200
     tatagaccag ggatacccat tttgtccgtg gtggttcctg aaatcacgtc tgactctttt      1260
     gattgggcgt gtagcaacga ggcaccggca agacacagtc tcatctaccg tggtttagtc      1320
     ccggtgctgt atgctggatc ggctagagcc tcgatcgacg agtcaacaga agaaactctc      1380
     gagttcgcgt cagagtatgg taaaaagaag caactctgca agaccggaga ctctgttgtg      1440
     gctctcttcc gtacaggtaa cgctattgtt atcaagatct tgaccgtcaa gtga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page