(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26400

AL161565.AT4G26400   Location/Qualifiers
FT   CDS_pept        complement(42131..43165)
FT                   /gene="AT4g26400"
FT                   /product="putative protein"
FT                   /note="similarity to RING zinc finger protein, Gallus
FT                   gallus"
FT                   /note="contains EST gb:Z34755, N65737"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:O65594"
FT                   /protein_id="CAB79495.1"
FT                   /translation="MVNPVIGAEIKCPFCQSGFVEEMSREINGGSSSSLREVQDPEIDF
FT                   GTDRALSLWGPILLGMMSNPRRRRRFRRTEFGVDNDEVNVSDDVDGNDSVDIDRHHHRR
FT                   HRHRQQGREIDLDREFESILRRRRRSSATILQLLQGIRAGIASEYESSDRDLLNQSAVV
FT                   QGSTSLNQNRNNTSLSAIGDYFVGSSLDHLLEHLADNDSIRHGSLPARKEVVDNLPTVK
FT                   ISESLQCSICLDDFDKGSEAKEMPCKHKFHIRCIVPWLELHSSCPVCRYELPPDDETKV
FT                   NPVRPRTRTLEINVSNENVEDDARNSNVSERRFSFPWPFSGLFSSSSSSSASASGSSHL
FT                   GENS"
     atggtgaatc cagttattgg tgccgagatc aaatgcccct tttgccaaag cgggtttgtc        60
     gaggaaatga gccgtgagat taatggcggc agcagtagca gtctaaggga ggttcaagac       120
     cctgagattg attttggtac agaccgtgca ttgtctctat ggggtccaat cttgcttgga       180
     atgatgagta atcctcgtag acgtagaagg tttaggagga cagagtttgg tgtggataat       240
     gatgaggtca atgtatctga tgatgttgat ggaaatgaca gcgtcgatat tgatcgacat       300
     catcatcgtc gtcatcgcca caggcaacaa ggtagagaga ttgatttaga cagagagttt       360
     gagtctatcc ttaggaggag acggagaagc tcagctacta tattgcagtt gcttcagggt       420
     attcgtgcag ggattgcttc tgagtatgag agctcggatc gagacctgtt aaatcaatca       480
     gctgttgttc agggttcaac gagtttgaat caaaaccgga acaatacttc tctttctgca       540
     attggagatt actttgttgg atccagttta gaccatttgc ttgaacatct agctgataat       600
     gattcaatca ggcacgggag tcttccagca cgtaaagaag ttgtggataa tctcccaacg       660
     gttaagataa gtgaatcatt gcagtgctcg atttgtttgg atgattttga caaaggaagt       720
     gaagctaaag agatgccgtg taagcacaag tttcacatcc ggtgtatagt accgtggctc       780
     gagcttcaca gttcatgtcc cgtgtgccga tatgaactcc ctcctgatga tgagaccaag       840
     gttaatcctg taagaccgag aacaagaact ctagagatca acgtaagtaa tgagaatgtg       900
     gaagatgatg caaggaacag taatgtgagc gagagaaggt tctcttttcc atggccgttc       960
     agcggattat tctcttcatc ctcttcgtca tccgcatcgg cctcggggtc atctcatctc      1020
     ggtgagaact cgtaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page