(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26410

AL161565.AT4G26410   Location/Qualifiers
FT   CDS_pept        join(43938..44180,44673..44739,44956..45033,45269..45467,
FT                   45555..45619,45735..45793,45880..45969)
FT                   /gene="AT4g26410"
FT                   /product="putative protein"
FT                   /note="contains EST gb:T46533, AI999195.1, AA394459"
FT                   /db_xref="GOA:Q84K90"
FT                   /db_xref="InterPro:IPR016803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84K90"
FT                   /protein_id="CAB79496.1"
FT                   /translation="MSETEATGVTDDSAPAIETETVSDAMEHTAIGVVESVEGAIEGAE
FT                   KWVGDLQRTVKESKDTAMRSARSLRENSTSQFRSIQDFIPHALTQYKTYENAFFSKVTD
FT                   ELIYAKEHPAAAIGIGVAASLVLMRVALVCVPSLIFTSTSKSSSLQAQFLKAEKHVQEL
FT                   NMSVDLMKKESRKLLERTALAEKDMKRGLSELMNSGNDIHRLAKSVHKAECEAADLMDG
FT                   LRQIPGRDAIKLRAEVASMTSLLRQKRIALNKRIMGMSDLGVSV"
     atgagcgaaa ccgaagcaac cggcgttacc gatgattcgg ctccagcgat tgagactgaa        60
     actgtttctg atgcgatgga gcatacagcg atcggagtgg ttgaatcggt ggaaggagcc       120
     atagaaggag cagagaaatg ggtgggtgat ttgcaacgga cggtgaagga atcgaaggat       180
     accgcaatgc gttctgctcg ttccctccgt gaaaattcta cctctcagtt ccgctctata       240
     caggatttca ttccacatgc tttgactcag tataagacct atgagaatgc tttcttcagt       300
     aaagttacag acgaattgat atacgcaaaa gagcatccgg ctgctgctat tgggattggt       360
     gtcgctgcta gtctcgttct gatgcgagtt gccctggtct gtgtcccttc ccttattttt       420
     acatccactt caaaatcatc gtcgcttcag gcacaattct tgaaagctga gaagcatgtt       480
     caggagttaa acatgtctgt agacttgatg aaaaaggaga gcaggaaatt gcttgagagg       540
     acggctttag cagagaagga tatgaaacgt ggtctctctg agctcatgaa ctctggaaac       600
     gatatacatc gtcttgctaa gtccgtccac aaagctgaat gtgaagctgc tgatttgatg       660
     gacggacttc ggcaaattcc tggaagggat gctatcaagc ttagagctga agtggcttcc       720
     atgacttcgc ttttgagaca gaagaggatt gcattgaaca aaaggatcat gggtatgtcg       780
     gacctaggag tttccgtctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page