(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26420

AL161565.AT4G26420   Location/Qualifiers
FT   CDS_pept        complement(join(46316..46805,47197..47520,48157..48431,
FT                   48520..48807,49182..49664))
FT                   /gene="AT4g26420"
FT                   /product="putative protein"
FT                   /note="similarity to various predicted proteins,
FT                   Arabidopsis thaliana"
FT                   /note="contains EST gb:AI999195.1, AA394459"
FT                   /db_xref="GOA:F4JUY5"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042086"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4JUY5"
FT                   /protein_id="CAB79497.1"
FT                   /translation="MESSRSLEHVLSMQGGEDDASYVKNCYGPAARLALSKPMLTTAIN
FT                   SIKLTEGCSSHLKIADLGCAIGDNTFSTVETVVEVLGKKLAVIDGGTEPEMEFEVFFSD
FT                   LSSNDFNALFRSLDEKVNGSSRKYFAAGVPGSFYKRLFPKGELHVVVTMSALQWLSQVP
FT                   EKVMEKGSKSWNKGGVWIEGAEKEVVEAYAEQADKDLVEFLKCRKEEIVVGGVLFMLMG
FT                   GRPSGSVNQIGDPDSSLKHPFTTLMDQAWQDLVDEGLIEEEKRDGFNIPVYFRTTEEIA
FT                   AAIDRCGGFKIEKTENLIIADHMNGKQEELMKDPDSYGRDRANYAQAGLKPIVQAYLGP
FT                   DLTHKLFKRMRGRGPRSGFASSCGGDGSTLTLNQHQKNDVGPSVTPENTPFGGGSPRTL
FT                   EEMILQLEVEEDIVRRARLRESYYGTYDNCDDHNDVDDDKLYHQPARMSCVNSSDILRS
FT                   ARNALNQYPRFSLDGKDAMYRSSFRRHLGTSADMTIQGGRRSHCGDQRTSKRSSQMSLE
FT                   TKRLPRTVAGESVVWCKTGVVAKLMGLEMIPVPDKGKSGKDKLGTLLKRERLRRRERTL
FT                   DVNGRTGPTTEASCSSGGFNITRPIGAVGSPSRMGGWPTARLP"
     atggagtcgt cacggagcct cgagcacgtg ctctccatgc aaggtggcga ggatgacgcg        60
     agctacgtca aaaactgtta cggtccagcg gcacgtttag ccttgagcaa accaatgctg       120
     acgacagcca tcaactccat aaagctcacc gaaggttgct cctctcacct gaaaatagcc       180
     gatttaggtt gcgcaatcgg agacaacacg ttttccacgg tggaaacggt ggttgaggtg       240
     ttagggaaga agctagccgt gattgacggt ggaaccgagc cggagatgga gttcgaggtc       300
     ttcttctctg acttgtcttc caacgatttc aacgcgttgt ttcggtcgtt ggatgagaaa       360
     gtgaacggtt cgagccgaaa gtacttcgcg gctggcgttc ccggctcgtt ctataagcgt       420
     ctgtttccga aaggagagct ccatgtcgtt gtgactatgt ctgctttaca atggctctct       480
     caggtacctg aaaaagtgat ggagaaagga tcgaagtcat ggaacaaggg aggggtgtgg       540
     attgaaggag cagaaaaaga agtcgtggag gcatacgcgg agcaagcaga caaggactta       600
     gtcgagttct tgaaatgtcg caaagaggag attgtggtag gaggagtgtt gtttatgctg       660
     atgggtggtc gaccttctgg ctccgtgaac caaatcggtg atcctgattc gagtctcaaa       720
     caccctttca caactttgat ggatcaagct tggcaagatc tagtagatga gggtttaata       780
     gaagaggaga agagagatgg tttcaacatt ccggtgtact ttagaaccac cgaagagatt       840
     gcggcggcga ttgatcgttg tggtggtttt aagatagaga aaacggagaa tctgataata       900
     gctgaccaca tgaatggtaa gcaggaagag ttgatgaaag atccggattc gtacggtcga       960
     gatagggcta actatgctca agccggttta aagccgatcg ttcaggccta tcttggtcct      1020
     gacctaactc ataagctctt caaacgaatg cgaggacgag gtccacgtag cggctttgct      1080
     agctcttgtg gtggtgatgg ctcaactttg acactaaacc aacatcaaaa gaacgatgtg      1140
     gggccttctg ttacacctga aaacactcct ttcggtggag gatctccgag aactctagag      1200
     gagatgatac ttcagctaga ggttgaagaa gatattgttc gaagagcgag actccgtgaa      1260
     tcttactacg gtacttacga taattgtgat gaccataatg atgttgatga tgataagtta      1320
     tatcatcagc ccgcccggat gtcatgcgtt aacagttccg atattttgag gtcagcaagg      1380
     aacgcgttga atcagtaccc acgtttctca ctggacggta aggacgctat gtaccggtca      1440
     tccttccggc gccatcttgg caccagtgct gacatgacga tacagggtgg gcggagatcc      1500
     cactgcgggg atcaacggac atcaaagaga tcgagccaga tgagcttgga gacaaaacgc      1560
     ctgccacgga cagtggccgg agagagtgtg gtatggtgca agacgggggt tgttgcaaag      1620
     ctgatgggtc tggagatgat acctgttccg gacaagggaa aatcgggaaa agataagtta      1680
     gggactctgc tcaagaggga gcgtctaagg aggagagaac ggactctgga cgttaatggt      1740
     cggaccggtc cgacgactga agcttcttgc tcgtctggag ggtttaacat tactagacca      1800
     atcggagcag ttgggtcgcc tagtcgcatg ggtggatggc ccacagcccg tctcccatag      1860
//

If you have problems or comments...

PBIL Back to PBIL home page