(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26430

AL161565.AT4G26430   Location/Qualifiers
FT   CDS_pept        join(52406..52703,52784..52872,52960..53053,53149..53210,
FT                   53301..53379,53754..53854,53984..54039,54422..54503)
FT                   /gene="AT4g26430"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein YOR261c, yeast,
FT                   PIR2:S67158"
FT                   /note="contains EST gb:T21187"
FT                   /db_xref="GOA:Q8W1P0"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR033859"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8W1P0"
FT                   /protein_id="CAB79498.1"
FT                   /translation="MAPSSSSGLTFKLHPLVMLNISDHFTRVKTQLNPPAASCATGNGS
FT                   NNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIFDPALDTLDRSFLEKKQELYKKVF
FT                   PDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFH
FT                   VIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSDGGSAATQCDKPCENSVLRQVSS
FT                   LLRSLPAAESEKFNENFLMEYNDKLLMSYLAMITNCTSNMNEVVDKFNTAYDKHSRRGG
FT                   RTAFM"
     atggcgcctt cttcgtcgag cggtctcacg ttcaagctac atcctctggt gatgcttaac        60
     atatccgatc acttcactag ggttaaaact cagcttaatc ctcccgccgc ttcttgcgcc       120
     accgggaatg gctccaacaa cgccgacgcg atgttactgc aaaaccctag ggtttatggc       180
     tgcgtcatcg gtctccagag aggtcgtacg gttgagatct tcaacagttt cgagctgata       240
     ttcgatcctg ctcttgatac tctcgacaga tccttcctcg agaagaagca agaactctat       300
     aagaaggtgt tccctgactt ctacgtattg ggatggtatt ctacgggaag tgacgctacc       360
     gaatctgata tgcatatcca caaagctctg atggacatta atgaatctcc tgtgtatgtt       420
     cttttaaatc ctgctatcaa tcatgcacag aaggatcttc ctgtgactat ctacgaaagc       480
     gaatttcatg tcattgatgg aattcctcag tcgattttcg tgcataccag ctacacaatt       540
     gagacagttg aagctgaaag aatatctgtt gatcatgttg cacatcttaa gccatctgat       600
     ggaggctcag ctgcgactca gtgtgataaa ccttgtgaga actcagttct gagacaagta       660
     tctagtctgc tcagaagttt gcctgccgca gaatcagaga agttcaatga aaatttcttg       720
     atggagtaca acgacaaatt gctgatgtct tacctagcaa tgatcacgaa ttgtaccagc       780
     aacatgaacg aggtggttga caaattcaac actgcatacg acaaacacag ccgaagaggt       840
     ggtaggactg cgttcatgta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page