(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26440

AL161565.AT4G26440   Location/Qualifiers
FT   CDS_pept        complement(join(54773..55304,55381..55539,55627..56324,
FT                   56410..56727))
FT                   /gene="AT4g26440"
FT                   /product="putative protein"
FT                   /note="similarity to SPF1 protein, Ipomoea batatas,
FT                   PIR2:S51529"
FT                   /note="contains EST gb:N37131, AA585811, T44598,
FT                   AI995443.1, AI993164.1, T45479, F14100"
FT                   /db_xref="GOA:O65590"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65590"
FT                   /protein_id="CAB79499.1"
FT                   /translation="MAGIDNKAAVMGEWFDCSTTNHRKRSKAELGREFSLNYIKNEDSL
FT                   QTTFQESSRGALRERIAARSGFNAPWLNTEDILQSKSLTISSPGLSPATLLESPVFLSN
FT                   PLLSPTTGKLSSVPSDKAKAELFDDITTSLAFQTISGSGLDPTNIALEPDDSQDYEERQ
FT                   LGGLGDSMACCAPADDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEAKKKVERSREGHI
FT                   IEIIYTGDHIHSKPPPNRRSGIGSSGTGQDMQIDATEYEGFAGTNENIEWTSPVSAELE
FT                   YGSHSGSMQVQNGTHQFGYGDAAADALYRDENEDDRTSHMSVSLTYDGEVEESESKRRK
FT                   LEAYATETSGSTRASREPRVVVQTTSDIDILDDGYRWRKYGQKVVKGNPNPRSYYKCTA
FT                   NGCTVTKHVERASDDFKSVLTTYIGKHTHVVPAARNSSHVGAGSSGTLQGSLATQTHNH
FT                   NVHYPMPHSRSEGLATANSSLFDFQSHLRHPTGFSVYIGQSELSDLSMPGLTIGQEKLT
FT                   SLQAPDIGDPTGLMLQLAAQPKVEPVSPQQGLDLSASSLICREMLSRLRQI"
     atggctggta ttgataataa agctgctgta atgggagaat ggttcgactg tagtactact        60
     aaccacagga agagatcgaa agcggaactt ggtagagagt tttctttaaa ttacatcaag       120
     aatgaggatt ctttgcaaac cacctttcaa gaaagttcac gaggagctct tcgtgaaagg       180
     attgctgcga gatccgggtt taatgcaccg tggttaaaca ctgaggatat tcttcagtcg       240
     aaatctttaa ccatctcttc tcctggtctt agtcctgcaa ctctgttaga gtctcctgtt       300
     ttcctctcaa accctttgct atctccaaca accgggaagc tctcatcagt accttctgat       360
     aaggctaaag ctgagttatt tgacgacatt accacatcct tagccttcca aaccatttca       420
     ggaagtggcc ttgatcctac taacatcgct ttagaacccg atgattccca agactatgaa       480
     gaaagacagc tcggcggttt aggagactcg atggcttgtt gtgcacctgc agatgatgga       540
     tacaactgga gaaaatatgg acaaaagcta gttaaaggaa gtgagtatcc gcggagctat       600
     tacaagtgca cgcacccgaa ttgtgaggcc aagaagaagg ttgaacggtc tcgggaaggt       660
     catattatag agatcatata cacaggagat catatacaca gcaaacctcc acctaaccgc       720
     cggtcaggga ttggatcatc cggtactggc caagacatgc aaatagatgc aaccgaatac       780
     gaaggttttg ctggaaccaa tgagaacata gaatggacat cacctgtatc tgcagagctc       840
     gaatacggaa gccattcagg atcaatgcag gttcaaaacg ggactcatca gttcgggtat       900
     ggtgatgcag cagctgatgc cttatataga gatgaaaacg aagatgatcg cacgtcccac       960
     atgagtgttt ccctgactta cgatggagag gtagaagagt ccgaatcaaa gagaaggaaa      1020
     ctagaagctt atgcaacaga aacgagtgga tcaaccagag ccagccgtga gccaagagtt      1080
     gtggtgcaga ccacaagtga cattgacatc ctcgatgatg gttatcgctg gcgcaagtat      1140
     gggcaaaaag tcgttaaagg aaacccgaat ccaaggagct actataaatg cacagctaat      1200
     ggatgtaccg taacgaagca tgtagagaga gcctctgatg acttcaagag cgtactaaca      1260
     acttatatag gcaagcacac ccacgttgta ccagcagcac gcaacagcag ccacgtcggt      1320
     gcaggcagtt cagggactct ccaaggcagt ttagcgactc agacccacaa ccacaatgtg      1380
     cactatccaa tgccacacag tagatctgag ggactggcca cagccaactc atctctattt      1440
     gacttccagt cacacctgag gcatcctaca ggtttctccg tttacatagg ccaatctgag      1500
     ctttctgatc tttcaatgcc tggtctaact attgggcaag agaagcttac cagcctgcag      1560
     gcgcctgaca ttggggatcc aactggccta atgttgcagt tagcagcaca gccgaaggtg      1620
     gaaccagtgt caccacaaca gggacttgat ttgtcagcga gctcattgat atgcagagag      1680
     atgttgagta gattacgaca gatatga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page