(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26450

AL161565.AT4G26450   Location/Qualifiers
FT   CDS_pept        join(59733..61570,61651..61804,61862..61958,62897..63796,
FT                   63975..64454,64827..64914,65666..65855)
FT                   /gene="AT4g26450"
FT                   /product="putative protein"
FT                   /note="contains EST gb:N96063, T45506, AA395523"
FT                   /db_xref="GOA:Q8GXA4"
FT                   /db_xref="InterPro:IPR040276"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CB21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8GXA4"
FT                   /protein_id="CAB79500.1"
FT                   /translation="MHARQRNVGNGYRSGSIGMGMSGSRISPERPMRGHGFYGSEHQHR
FT                   GFNRGYGRGRGRSKSYHNQLPPPLPPPPVQRRSSGGDVFMEAGRLATEYLVSQGVLPQT
FT                   VLSSKWQNGNFRKQAGEFQSSRSQEEARMDVSAPAAEKRRYIDGYSSAGSRNSLKGRRS
FT                   HRYDSDFGRSGSWSERSKAFETETGDDSVSGHQEEQPLAEDIASSVQRSASGEFMRKCE
FT                   GAGDSESVLDKYNLQDEAQSKTGSSSAGKDIVQDCEISKVSEGSSSLSAGSGEMKGRSG
FT                   GNGGEDENQTAIEDGSIHQRCEDASIDQQCGADESFTKSGIDLATLCKFEKVPTRTRSS
FT                   LTAKGPKLYLSHNIKDTSHNSGLEEEDQTENRCETRGQSSGKADSTGDENDQVEDFALV
FT                   QYIENSKCHRSNSFPSSILRDNSEKESGLELPNLHRSHSVGKVGEKRPGEGSDLEEGSK
FT                   RQRDWVAVSEANERFNMFKTSGNQCDPEEEGKTSSFNKRLIDGAAGKRVSHESLVNNST
FT                   YNRTHTGRTGPGYAEEHQLFPASFKMCDLNLGGASDVNDGIKESRQAVDFDLSISSSSK
FT                   SLEFGTSTRMSNGKEIEVINLDDDQEVVKSSNDPGRKQEAAPYMGIDDVPDYNERLMMV
FT                   EYLDSFTPINQGTSSVPQNNNTVSLQDREILKTSQGAIGNDQVPNNTDDDSIFMSLGEI
FT                   PLNFFVESMDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNS
FT                   VELGKPMSFDSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGV
FT                   AHSHGKQMQFQSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMD
FT                   LEIDDDRSSKSSTVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSS
FT                   LESDSRKQSGRMMDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLA
FT                   LQDALEKEVQQFQEIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLE
FT                   VKESHIRDLESTTNQSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLID
FT                   EQESLAEEQTHETLNKLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRAFNTNKAKTAV
FT                   AAEINSEIKRGVESAVEAFRKRRPIRNKLKMEGGEGRQQKDIPDMELEEERDTNSAIRK
FT                   KNNNISSMKLLLKKLVTFSKKNT"
     atgcatgcta ggcaacgcaa tgttgggaat gggtacagat ctggttctat tgggatgggt        60
     atgtctggtt ctagaatttc tcctgagcgt cctatgagag gacatgggtt ctatggttct       120
     gaacaccaac accgtggctt taaccgtgga tatggacgtg gaaggggacg ctctaaatca       180
     taccacaatc agctgcctcc gcctctgcct cctccaccgg tgcagcgtag aagcagtggc       240
     ggtgacgttt tcatggaggc aggtcgtcta gcaacagagt acttggtttc tcaaggtgtt       300
     ctaccacaaa ctgtgctttc cagtaaatgg cagaatggta attttaggaa gcaagctgga       360
     gagtttcaga gttccaggtc tcaagaagaa gcccgaatgg atgtttcagc tccagctgca       420
     gagaaaagga ggtatattga tggctatagc tcagctggat ccaggaatag cttgaaagga       480
     aggagatccc accgttatga ctcggatttt gggaggagcg gatcttggtc agagagaagt       540
     aaagcttttg agactgagac tggtgacgac tctgtgtctg ggcatcaaga agagcagccg       600
     cttgctgaag atattgctag ctcggttcag cggtcagcct ctggtgaatt tatgagaaaa       660
     tgtgaaggag caggtgattc cgagtctgtg ttggacaagt acaatctcca ggatgaggca       720
     cagtctaaga caggttcctc gagtgccggg aaagatatag tacaggattg tgaaatctct       780
     aaagtatccg aaggctcttc tagcttgagt gctggatcag gagagatgaa aggtaggtct       840
     ggtggtaatg gtggagagga tgagaaccag actgctatcg aagatggatc tatccatcaa       900
     cgttgtgaag atgcatctat tgatcaacag tgtggggctg atgaatcatt caccaagagt       960
     ggtattgatt tggcaacgct gtgtaaattt gagaaggtgc ctacgaggac acgctcttct      1020
     ctgactgcaa aaggcccaaa gctttatttg agtcataata tcaaggatac ctctcataat      1080
     tctggacttg aagaagaaga tcaaaccgaa aatcgatgtg agactcgagg ccaatcatct      1140
     ggaaaggccg atagtactgg tgatgaaaat gaccaagttg aagattttgc tcttgttcaa      1200
     tatattgaga acagtaaatg tcataggtct aattcttttc ccagtagcat tctcagggat      1260
     aacagtgaga aagaatcagg attagaattg cctaatctgc acagatcaca ttcggtgggg      1320
     aaagtaggtg agaaaaggcc tggtgaaggc agtgacttgg aggagggatc aaaaagacag      1380
     agagattggg tggcagtttc tgaagctaat gaacgcttca acatgtttaa aacaagcgga      1440
     aaccaatgcg atccggaaga agaaggaaag acaagctcgt tcaacaaaag actgattgac      1500
     ggtgctgctg gaaaaagggt cagccatgaa agtctggtta ataactctac atacaatagg      1560
     acacacactg gcagaacagg tccagggtat gctgaagaac atcagctgtt tcctgcttcg      1620
     tttaagatgt gtgacctaaa tctaggggga gcgtcggatg tgaatgatgg gataaaggaa      1680
     tctcgtcaag ctgttgattt tgatctctca atcagcagtt ctagtaagtc tctcgagttt      1740
     ggtacgagta ctcggatgag caatggtaaa gagatagaag tgattaattt ggatgatgat      1800
     caagaagtgg taaagtccag caatgatcca ggaagaaagc aagaagctgc tccatatatg      1860
     ggcatcgatg acgtcccaga ctacaatgaa agactcatga tggtagagta tcttgattcc      1920
     tttactccaa taaaccaggg aaccagtagt gtcccacaga ataacaacac agttagcctt      1980
     caagaccgag agatcctgaa aacgtctcag ggagctattg gaaatgacca agtaccaaat      2040
     aatacagacg atgattcgat cttcatgtca ctcggagaaa taccattgaa tttttttgtg      2100
     gagtcaatgg atttggagag tgaaagctct gcacttgagt ctgttgatga taatgttttg      2160
     attcaacaaa gtgccagcaa cgtttgtgat gatggtagga gtttggataa cgggtcttgc      2220
     tctgatgaga gtgtgaaact gctttcgact tctaattctg ttgaactcgg taaacctatg      2280
     agttttgatt caccaggtga tggtggtggt gcttattctc cggttttgaa aggacaaggc      2340
     ttgagaaaat ggaggaggat taggagagat cttgttaagg acacgtctgc gaatatggag      2400
     aatagtaaag ctctgaagag agggttgtca ggtgttgctc attcacatgg taaacagatg      2460
     cagtttcagt caccggaagt tgaacaagag agtcagggat ctgttgggtc tgttaatatg      2520
     ttgaaaagta gcggtgatgg ttttgatata cttgggagta gtggttacga ttctaggttt      2580
     gtggcagggg ttggtttttc agctggtatg gatttagaga tagatgatga tcggagtagt      2640
     aagtcttcca cggttgcaag agctcccaag gttattaggt atgagaagcc aatgattagt      2700
     tcaggtcagg gaggaaacat tcgtgtagag aatagtaaga aacatagagg agaaagtgtc      2760
     gatttcgaga aggaaaactc ttattccagc ttggaatctg actcaagaaa gcagagtgga      2820
     agaatgatgg actacaatgg tgaaaatggg gaaacgtcaa tgagaaaaga tgatgcggga      2880
     ggagaaggcg gagagtcgat aaacacggac aatcgttact cagatgaaat ggatccatta      2940
     acagaggcca tcaacggttt cttggccttg caagatgctc ttgaaaaaga ggttcagcaa      3000
     ttccaggaga tcgggaatga accaatgcca cagcatcatg aacaagtcag cgaagcaaat      3060
     tcacctcacc ccgagattgt aaccctggta aacaatgttg aacaactgga gaacatgcta      3120
     gaagaaacaa ggtccatgct tgaggtgaaa gaatcacaca tccgtgacct tgaatccacc      3180
     acgaaccaaa gcaaacactc gtggggagga acagagattg tggttgaaga catcttccgg      3240
     cagaagattg aggccgagat tgaatatctg atatattcaa gatctatcga taacttaaac      3300
     agtcagatga agttaattga tgaacaagag tcattggcag aagagcaaac ccatgagacg      3360
     ctgaataagc taggaagagt acaaacgaag gctgcaaatt ttacaaacag agctcaagac      3420
     ctgcaaaacg attgcataga aatcaccggg accatcaaga agagagcatt caacactaac      3480
     aaagcaaaaa cagcggttgc agcagagatc aacagcgaga taaaacgagg agtcgaatca      3540
     gcagttgagg cgtttagaaa gcgacgaccc attagaaaca aattaaagat ggagggtgga      3600
     gaaggaagac aacaaaaaga catacccgat atggaacttg aagaggagag agataccaac      3660
     agtgccatca gaaagaagaa taataatatc agctccatga aattgttgtt aaagaagctt      3720
     gtaacatttt caaagaagaa tacataa                                          3747
//

If you have problems or comments...

PBIL Back to PBIL home page