(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26460

AL161565.AT4G26460   Location/Qualifiers
FT   CDS_pept        join(66707..66928,67036..67188)
FT                   /gene="AT4g26460"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:O65588"
FT                   /db_xref="InterPro:IPR005299"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:O65588"
FT                   /protein_id="CAB79501.1"
FT                   /translation="MLIYALDFFIRFPRKDDSQIMELCIGTVNNGTSDKTADQIKATME
FT                   AAYRVLYRHAPLPRNIFGPMFPMSYLHVAVPEKVVENGWNKRKAWIEGSDRQVLMRYAE
FT                   QADKDLVDFLAEPCRGILMP"
     atgctaattt acgcattgga ttttttcatc cgatttcctc gaaaggatga ctcacagatc        60
     atggaattgt gtataggcac ggttaacaac ggcacaagtg acaagacggc ggaccaaatc       120
     aaggcgacaa tggaagcggc ttaccgtgta ttatataggc atgcaccttt acctcgcaat       180
     atatttggtc ccatgttccc gatgtcttac ctccatgtcg cagtaccgga gaaagtagta       240
     gagaatgggt ggaacaaaag gaaggcgtgg atagaaggat ctgatcgaca agtgttgatg       300
     cgttacgcgg agcaagcgga caaggactta gtcgactttt tggcagagcc gtgccgagga       360
     attttgatgc catag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page