(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26470

AL161565.AT4G26470   Location/Qualifiers
FT   CDS_pept        join(68554..68752,68831..69033,69141..69309,69345..69520)
FT                   /gene="AT4g26470"
FT                   /product="putative protein"
FT                   /note="similarity to probable calcium-dependent protein
FT                   kinase, Oryza sativa, PIR2:S56652"
FT                   /note="Contains EF-hand calcium-binding domain
FT                   AA67-79;EF-hand calcium-binding domain AA158-170;EF-hand
FT                   calcium-binding domain AA211-223"
FT                   /note="contains EST gb:H77175"
FT                   /db_xref="GOA:Q52K82"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q52K82"
FT                   /protein_id="CAB79502.1"
FT                   /translation="MGGAVTKSETLQKEWVPETKLEAKIIEAVQRRASRGTTMKSFNSI
FT                   VLKFPKIDDGLRNCKAIFQEFDEDSNGSIDHTELKNCIRKLEISFDEEEINDLFKACDI
FT                   NEDMGITFTEFIVLLCLVYLLKDDSSTLQKKWTMGMPKLEPTFETLVDTFVFLDENKDG
FT                   YVSREEMVRAIDESGERSSGRIAMKRFAFFFTEPRILILIPVSAEEMDWDKNGMVNFKE
FT                   FLFAFTQWVGIDENEEEEEEDNNEKA"
     atgggaggtg cagtgacgaa atctgaaact ctgcaaaaag aatgggttcc agagacaaag        60
     ttggaggcta agatcataga agccgtgcaa cgcagggcat cgaggggcac cacaatgaaa       120
     tctttcaaca gtattgttct caagttccca aagatcgatg atggtcttcg aaactgcaaa       180
     gccattttcc aagaattcga tgaggattca aacgggtcaa tagatcacac ggagctaaag       240
     aattgtatca ggaagctaga gatctcgttc gatgaagaag agattaatga tttgttcaag       300
     gcttgcgata ttaacgagga tatgggaatt acatttacag aattcattgt tcttctttgc       360
     ctcgtctatc ttcttaaaga cgattcatcc actctccaaa agaaatggac aatgggaatg       420
     ccaaagctgg aaccaacatt cgagacgctt gttgacacat ttgtgttcct agacgagaac       480
     aaggacggat atgttagccg cgaggagatg gtccgagcca ttgatgaatc aggagaacga       540
     tcctccgggc ggattgcaat gaagagattt gctttcttct tcactgaacc aagaatattg       600
     attttgattc ctgtgtctgc agaggaaatg gactgggaca agaacggaat ggtgaacttc       660
     aaagagtttc tcttcgcatt tacgcagtgg gttgggatag atgagaatga agaagaagaa       720
     gaagaagaca acaatgagaa agcttaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page