(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26480

AL161565.AT4G26480   Location/Qualifiers
FT   CDS_pept        complement(join(70062..70208,70301..70444,70527..70643,
FT                   70719..70832,71310..71449,72060..72145,72792..72999,
FT                   73356..73413,73911..74083,74897..75138,75229..75433,
FT                   75534..75567))
FT                   /gene="AT4g26480"
FT                   /product="putative protein"
FT                   /note="similarity to qkI-7, Mus musculus"
FT                   /note="contains EST gb:H76841, T21753, H36880"
FT                   /db_xref="GOA:Q0WLR1"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR019446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032377"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C8L4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0WLR1"
FT                   /protein_id="CAB79503.1"
FT                   /translation="MNITATSLDSEDELSIKYMDAVDNINILKRYGCDIQHEVDVHTMS
FT                   FDNSLSLQRYDRIVFNFPHAGSRFFGRELSSRAIESHKELVRGFLENAKEMLEEDGEIH
FT                   ITHKTTYPFSDWGIKKLGKGEGLKLLKKSKFELSHYPGYITKRGSGGRRSDDYFPVDVD
FT                   PCDLKGFEVLEIYHPSMSDGFVNSVMVARKLTDRLIKYEWCTGTRSLNSLKKTRQTEPD
FT                   QFNKREINRSGPGQVAEEEEEVVAVMMMMTSLGGGAGGGGGGGGSGGGRFVTYPPPLSV
FT                   PPSAPQSPNFSGGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRV
FT                   TTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGS
FT                   SSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPI
FT                   KEDMMRGKPGYEHLNEPLHILVEAELPIEIVDARLMQAREILDDLLTPVEETHDFYKKQ
FT                   QLRELALLNGSLREEGSPMSGSISPYNSLGMKRAKTRG"
     atgaacataa ctgcgacctc tctcgattct gaagatgaac tgagcataaa atatatggat        60
     gcggtggata acataaacat attgaagaga tacgggtgtg atattcagca cgaggttgac       120
     gtgcacacaa tgagcttcga taatagtttg agtctgcaac gttatgaccg cattgtcttc       180
     aattttcctc acgcagggtc tcgtttcttt ggtcgtgaat tgtcctctag ggccatcgag       240
     agccacaaag agttagtgag aggatttctt gagaacgcta aggagatgtt ggaagaggac       300
     ggagagatcc atattacaca caagacaacg tatccattta gcgattgggg gataaagaag       360
     ctgggtaaag gagaaggttt gaagctgctt aagaaatcga agttcgagct gagtcattat       420
     ccgggttata tcaccaagag agggagtggt ggacgtagga gtgatgatta tttccctgtt       480
     gacgttgatc cttgtgatct aaaaggtttc gaggtcttgg aaatctatca cccgtccatg       540
     tctgatggct ttgtgaactc ggtaatggtc gcacgcaaac tcactgatcg attaattaag       600
     tacgagtggt gtactggaac tcgatcacta aattcattaa aaaaaacaag gcaaaccgaa       660
     ccggatcaat tcaacaaacg tgaaataaat cgaagcgggc caggtcaagt agctgaggaa       720
     gaagaagaag tagtagccgt gatgatgatg atgacgtcac ttggtggtgg tgctggaggc       780
     ggcggaggag gtggtggtag tggtggtggg agatttgtga cgtatccgcc gcctctatct       840
     gtgcctccgt cggctcctca gtcacctaac ttctctggtg gtctccgatc acagccttct       900
     ttcctcgttg agcaagagaa gtatctttct gagttacttg cagagcgtca caagcttact       960
     ccatttttgc ctgtgcttcc acatgtttgc cggctcatga accaagaaat tttgcgtgta      1020
     accacgctgt tggagaatgc cttaagtcag agtaggtttg atcaccctag ccctctggct      1080
     tctggaggga tatttcagaa ttcaagagct gacatgaacg gatgggcctc acaatttcca      1140
     tcagaaagat cggtttcatc atccccagca ccaaattggc ttaactctcc tggtagctcg      1200
     tccggtctca tcgtcaagcg aacaataagg gtggatattc cagtcgacaa atacccaaac      1260
     tacaattttg tcggtcgtct cttgggtcct agaggaaact ccctcaaacg agttgaagcg      1320
     agtactgatt gtcgtgttct aataaggggt agaggcagca ttaaagatcc gattaaggag      1380
     gatatgatga gaggtaaacc tggttatgag cacctcaatg aaccactcca catcttagtc      1440
     gaggcagaat tacccattga aatagtggac gcacgtctca tgcaagcccg tgaaatactc      1500
     gacgatctac ttactcccgt ggaggaaacc catgatttct acaagaaaca acagctacgg      1560
     gaattggccc ttctcaacgg cagtcttcga gaagaaggat ctccaatgtc tggttccatc      1620
     tcaccttaca atagcctcgg catgaagaga gctaagacaa ggggctaa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page