(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26490

AL161565.AT4G26490   Location/Qualifiers
FT   CDS_pept        join(77749..77872,77930..78408)
FT                   /gene="AT4g26490"
FT                   /product="hypothetical protein"
FT                   /note="contains EST gb:AI996141.1"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="UniProtKB/TrEMBL:O65585"
FT                   /protein_id="CAB79504.1"
FT                   /translation="MVLTKPATVRFNGLDAEPRKDRVILRQPRSSRTSLWIWCVAVFLA
FT                   IRPRIPVFDIPNANLHTIYFDTPEFFNGDLSMLVNFTNPNKKIEVKFEKLRIELFFFNR
FT                   LIAAQVVQPFLQKKHETRLEPIRLISSLVGLPVNHAVELRRQLENNKIEYEIRGTFKVK
FT                   AHFGMIHYSYQLHGRCQLQMTGPPTGILISRNCTTKK"
     atggtcttaa caaagccagc aacggttaga ttcaacggtc ttgatgcaga gccgaggaaa        60
     gatagggtga ttctccgtca gccaaggagt agcaggacca gtctctggat atggtgtgtt       120
     gccgtgtttc ttgcgattag accaagaata cctgttttcg acatcccaaa cgcaaaccta       180
     cacacgatct acttcgacac gccggagttt ttcaacggcg atttgtccat gctggtgaat       240
     ttcactaacc ctaataagaa gatagaagtg aagtttgaga agcttcggat tgagctcttc       300
     ttcttcaata gattgattgc agcgcaagtg gtccagccat tcttgcagaa aaagcatgag       360
     acgaggttgg aaccaatccg tttgatctct agtttggtag gcttgcctgt aaaccacgcg       420
     gtggaactca ggagacagct ggaaaacaac aagatagaat atgagattag aggtaccttc       480
     aaagtcaaag ctcattttgg aatgattcat tactcttatc agctgcacgg gaggtgccaa       540
     cttcagatga ccggtccacc aaccggaatc ctgatttctc gtaattgcac gacgaagaaa       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page