(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26500

AL161565.AT4G26500   Location/Qualifiers
FT   CDS_pept        complement(79633..80748)
FT                   /gene="AT4g26500"
FT                   /product="putative protein"
FT                   /note="similarity to Uvi31, Schizosaccharomyces pombe,
FT                   G1381578"
FT                   /db_xref="GOA:Q84W65"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="PDB:4PUI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q84W65"
FT                   /protein_id="CAB79505.1"
FT                   /translation="MAAAMSSSCCASSLRLIPFKRTLFSSIHYPAKTLLLRPLKPSEVP
FT                   SFRRTIITFQKISTGIVPPPSASSSPSSYGDLQPIEELPPKLQEIVKLFQSVQEPKAKY
FT                   EQLMFYGKNLTPLDSQFKTRENKVEGCVSQVWVRAFFDEERNVVYEADSDSVLTKGLAA
FT                   LLVKGLSGRPVPEILRITPDFAVLLGLQQSLSPSRNNGLLNMLKLMQKKALHLEVKGEE
FT                   DSSSGESSESSFVSIPETKDEANVPEVDLESKPDLVEDLGTEKIDDSESGSNVVALGSR
FT                   GMRIREKLEKELDPVELEVEDVSYQHAGHAAVRGSAGDDGETHFNLRIVSDAFQGKSLV
FT                   KRHRLIYDLLQDELKSGLHALSIVAKTPAEV"
     atggcagcag cgatgtcttc ttcttgttgc gcttcctcgc ttcgtttaat cccattcaaa        60
     cggaccttgt tttcttcaat ccattatccg gccaaaaccc ttcttctacg accactaaaa       120
     ccgtcggaag ttccttcctt tcgccggacg atcatcactt tccagaaaat ttcaaccggg       180
     attgttcctc caccatcggc ttcatcatct ccgtcgagct atggagacct tcaaccaatc       240
     gaagagcttc caccgaagct acaagagatc gtcaagcttt tccaatcggt acaagagcca       300
     aaggctaaat acgagcagct tatgttctac gggaagaatc tgacacctct cgattctcaa       360
     ttcaagacga gggagaataa agtagaagga tgtgtttctc aggtttgggt tagggctttc       420
     tttgatgagg aacgtaatgt tgtgtatgaa gctgattctg attcggttct cactaaaggg       480
     ttagctgctc tattagtcaa gggtttatct ggaagacctg tccctgagat tttgaggata       540
     acacctgatt tcgctgttct tctcgggttg cagcagagtc tgtctccttc tagaaacaat       600
     ggattactta atatgcttaa gctgatgcag aaaaaggctc ttcatttgga agtcaaaggt       660
     gaggaagatt caagttctgg agagagttca gaatccagct ttgtgtctat tcctgagact       720
     aaggacgaag ctaatgttcc ggaggtggat ttggagtcta aacctgatct agttgaggat       780
     ttgggaacag aaaagattga tgattctgag agtgggtcaa atgttgttgc tttagggagt       840
     agagggatga ggataagaga gaaattggag aaggagctag atcctgttga gttagaagtt       900
     gaagatgttt cttaccagca cgcaggacat gccgctgtta gaggtagtgc tggtgatgat       960
     ggggaaacac atttcaactt gcgaatcgtt tcggatgctt tccaaggtaa aagcttggtc      1020
     aagagacata ggctgatata tgacttgttg caagatgagt tgaagagcgg gttacatgct      1080
     ctctctattg tggcaaagac tcctgctgag gtttga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page