(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26520

AL161565.AT4G26520   Location/Qualifiers
FT   CDS_pept        join(85852..85879,85960..86213,86346..86774,87002..87367)
FT                   /gene="AT4g26520"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="Contains Fructose-bisphosphate aldolase class-I
FT                   active site AA217-227"
FT                   /note="contains EST gb:AI994456.1"
FT                   /db_xref="GOA:P22197"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22197"
FT                   /protein_id="CAB79507.1"
FT                   /translation="MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINV
FT                   ENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKV
FT                   DKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDA
FT                   RVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGT
FT                   LLKPNMVTPGSDSPKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAM
FT                   NKLDVLKPWTLTFSFGGALQQSAIKAWAGKPENVAKAQAKFLTRCKANKDATLGKYTGW
FT                   ASGDSAAFENLVVIGYRY"
     atgtctgctt ttgtcagcaa atacgaagat gagctgatca agacggccaa gtacattgca        60
     acgccgggaa ggggcatttt ggcggcagat gagagcacag aaaccattgg gaaacgattc       120
     gccggaatca atgttgagaa cactgagtcc aaccgccaag cttaccgtga gctcctcttc       180
     acttcccctg gcagttaccc ttgcctctct ggtgttatac tcttcgagga aaccctctac       240
     cagaaaacct ctgatggcaa acccttcgtc gatctcctca tggagaacgg tgttatcccc       300
     ggaatcaaag tggacaaggg tttggttgat ctagcaggga ccaacggcga gaccactact       360
     caaggtctag actcgcttgg tgcacggtgt cagcagtatt acgaggcagg agcccggttt       420
     gctaaatggc gtgcattctt caagattggg gccaccgagc caagcgttct ctccatccaa       480
     gaggacgcca gggtgctagc ccgctatgcc atcatctgcc aggagaatgg acttgtcccg       540
     atcgtcgagc cagaggtgct gacaggtggg agccacgaca tcaagaaatg tgcggcggtg       600
     actgagacgg ttcttgctgc cgtgttcaag gccttgaact accaccatgt cctcctcgaa       660
     ggcactctgc ttaaacctaa catggtcact cccggctccg acagcccaaa ggttgcaccg       720
     gaactaattg cggaatacac ggtgactgct ctgcgccgca cagtcccacc agctattccg       780
     ggaatcgtgt tcctctcagg catacagcgc gaagagcaag cgacactaaa tctaaacgca       840
     atgaacaagc ttgatgtgtt gaagccatgg acgctcactt tctcttttgg cggagccctc       900
     cagcaaagtg ctatcaaggc ttgggccggt aagcccgaga acgtagccaa agctcaggcc       960
     aagttcctga ccaggtgcaa ggctaacaag gacgctaccc tcgggaaata caccggctgg      1020
     gcttctggtg actcggccgc tttcgagaac ttggttgtga taggatacag gtactag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page