(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26530

AL161565.AT4G26530   Location/Qualifiers
FT   CDS_pept        join(88742..88769,88849..89102,89219..89647,89748..90113)
FT                   /gene="AT4g26530"
FT                   /product="fructose-bisphosphate aldolase-like protein"
FT                   /note="strong similarity to fructose-bisphosphate aldolase,
FT                   Arabidopsis thaliana, PIR1:ADMU"
FT                   /note="Contains Fructose-bisphosphate aldolase class-I
FT                   active site AA217-227"
FT                   /note="contains EST gb:AI994456.1, H36738, T44098,
FT                   AI099760"
FT                   /db_xref="GOA:O65581"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029768"
FT                   /db_xref="UniProtKB/Swiss-Prot:O65581"
FT                   /protein_id="CAB79508.1"
FT                   /translation="MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIGKRFASINV
FT                   ENIESNRQALRELLFTSPGTFPCLSGVILFEETLYQKTTDGKPFVELLMENGVIPGIKV
FT                   DKGVVDLAGTNGETTTQGLDSLGARCQEYYKAGARFAKWRAVLKIGATEPSELSIQENA
FT                   KGLARYAIICQENGLVPIVEPEVLTDGSHDIKKCAAVTETVLAAVYKALNDHHVLLEGT
FT                   LLKPNMVTPGSDSPKVAPEVIAEYTVTALRRTVPPAVPGIVFLSGGQSEEEATLNLNAM
FT                   NKLDVLKPWTLTFSFGRALQQSTLKAWAGKTENVAKAQATFLTRCKGNSDATLGKYTGG
FT                   ASGDSAASESLYEEGYKY"
     atgtctgctt ttgtcggcaa atacgcagat gagctgataa agacggctaa gtacattgcc        60
     acaccgggaa agggcatttt ggcagcagac gagagcacgg gaactattgg gaaacgattc       120
     gccagcatca atgttgagaa cattgagtcc aaccgccaag ctctccgtga gctcctcttc       180
     acgtcccctg gcactttccc ttgcctctcc ggtgttatcc tcttcgagga aaccctctac       240
     cagaaaacca cggatggcaa acccttcgtt gagctcctca tggaaaacgg agttatccct       300
     ggaatcaaag tggacaaggg tgtggttgat ctagcaggaa ccaatggcga gaccactact       360
     cagggtctag attcacttgg tgcacgttgc caggagtatt acaaggcagg agctcggttt       420
     gcaaaatggc gtgcagtcct caagattggg gccaccgagc caagcgagct ctctatccaa       480
     gagaacgcca aggggctagc ccgctatgcc atcatctgcc aggagaatgg actcgtccca       540
     atcgtcgagc cagaggtact gaccgacggg agccatgaca tcaagaaatg tgcagcggtg       600
     accgagaccg ttcttgctgc cgtgtacaag gccttgaacg accaccatgt cctcctcgaa       660
     ggcactctgc ttaaaccgaa catggtcact cccggctctg acagcccaaa ggttgcaccg       720
     gaagtgatag cggaatacac agtgactgct ctgcgccgca cagtcccacc tgcagttcca       780
     ggaatcgtgt tcctctcagg cggacagagt gaagaggaag caacactaaa tctgaacgca       840
     atgaacaagc tcgatgtgtt gaagccatgg actctcactt tctcatttgg ccgagccctc       900
     caacaaagca ctctcaaggc ttgggcaggt aagacagaga atgtagccaa agctcaggcc       960
     actttcctga ccaggtgcaa gggtaactcg gacgctaccc tcgggaaata caccggcggg      1020
     gcttctggtg actcggccgc ctctgagagc ttgtatgagg aaggatacaa gtattag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page