(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26540

AL161565.AT4G26540   Location/Qualifiers
FT   CDS_pept        complement(join(91849..92353,92396..93697,93921..95203))
FT                   /gene="AT4g26540"
FT                   /product="receptor protein kinase-like protein"
FT                   /note="strong similarity to Cf-2.1, Solanum
FT                   pimpinellifolium"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA691-713;Protein kinases signatures and profile AA804-816"
FT                   /note="contains EST gb:N37940, AA395026, T41929"
FT                   /db_xref="GOA:C0LGR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:5HYX"
FT                   /db_xref="PDB:5HZ0"
FT                   /db_xref="PDB:5HZ1"
FT                   /db_xref="PDB:5HZ3"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0LGR3"
FT                   /protein_id="CAB79509.1"
FT                   /translation="MPPNIYRLSFFSSLLCFFFIPCFSLDQQGQALLSWKSQLNISGDA
FT                   FSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLN
FT                   LTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGN
FT                   LSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLA
FT                   ETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTT
FT                   IGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQ
FT                   LSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIP
FT                   QSLSQCRELQAIDLSYNSLSGSIPKEIFGLEFLDLHTNSLSGSLLGTTLPKSLKFIDFS
FT                   DNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDE
FT                   LGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLN
FT                   ISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAISTRPDPTTRNSSVVRLTILILVV
FT                   VTAVLVLMAVYTLVRARAAGKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTG
FT                   SSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKL
FT                   LFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAM
FT                   NVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSLWLHGSSFDFDLFCLL
FT                   GFTEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPS
FT                   RLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDVGRSET
FT                   EKIKAGGCGSKEPQQFMSNEKIINSHGSSNCSFAFSDDSV"
     atgccaccaa atatctatag actctccttc ttctcatccc tactctgttt cttcttcatc        60
     ccctgtttct ctctcgacca acaaggtcaa gctctcttgt catggaagtc tcaactgaac       120
     atctccggcg acgctttttc ctcctggcac gtcgccgaca catctccctg caattgggtc       180
     ggcgtaaaat gtaaccgtag aggtgaagtt tcggagatac agctcaaagg tatggacttg       240
     caaggttctc tgccggtgac tagtctccgg agcctcaagt ctcttacttc cctcacttta       300
     tcttcactga atctcaccgg agtaatcccc aaggagatcg gagacttcac ggagcttgag       360
     ttactcgatt tgtcggataa ttctctctcc ggtgatatcc ctgtggaaat cttcaggctc       420
     aagaaactca agactctgtc tctgaacact aacaatctag aaggtcatat tccgatggag       480
     attgggaatc tttcgggtct cgtagagctt atgcttttcg acaacaagct atccggagag       540
     atcccaagga gtatcggaga gctcaagaat ctacaagtct tacgtgctgg tgggaacaag       600
     aatctaagag gtgagcttcc ttgggagata ggtaactgcg agaatcttgt aatgcttggt       660
     ctcgctgaga ctagtctctc cgggaaactt ccggcgtcga ttggaaacct gaaacgtgtt       720
     cagacaatag caatttacac gtcactcttg tctggtccaa ttccggatga gattggatac       780
     tgcacagagc tccaaaacct ctacttgtat cagaattcaa tctcaggatc gatccctacc       840
     accattggag gtttaaagaa gctgcagagt ctacttttat ggcagaacaa tctcgttggg       900
     aaaatcccaa ccgagcttgg gaactgtccc gagctctggc ttatcgattt ttccgagaat       960
     ctcctcaccg ggaccatccc aaggagcttc ggaaaacttg agaatctaca agagcttcag      1020
     ctgagtgtaa accagatctc aggaacaatc cctgaagagc taacgaattg cacgaagctg      1080
     acgcatttag agatcgacaa taatctcatc acaggagaga ttccgtcatt gatgagtaac      1140
     ctaagaagct taaccatgtt cttcgcatgg cagaacaagt taactggaaa catccctcaa      1200
     agtctctccc agtgtcgtga gcttcaagcc atcgatctct cttacaacag tctctctggc      1260
     tccatcccaa aagagatatt cggcctcgag tttctcgatc ttcacacgaa tagtctctcc      1320
     ggttcattgc tcggtactac actcccaaag agcttgaagt tcatcgattt ctccgataat      1380
     gctctgtcca gtactctgcc tccgggaata ggattgttga cagagcttac aaagctcaat      1440
     ctcgccaaga acagattatc cggcgaaatc cctagagaaa tctccacttg tcggagtcta      1500
     cagcttctca atctcggcga aaatgacttt tctggtgaaa tccctgacga attgggtcaa      1560
     atcccgtctc tggcgatatc tcttaatctc agctgcaata ggttcgtcgg agaaatcccg      1620
     tctagattct ccgacttgaa aaaccttgga gtgctcgacg tatctcacaa ccaactcacc      1680
     ggaaacttaa acgttttaac ggatttgcaa aacctcgtct ctctcaacat ctcctacaac      1740
     gatttctccg gcgatttacc caacacgccc tttttccggc gacttccact ttctgatctc      1800
     gcctcaaaca gagggcttta catctcgaac gcaatctcga cccgacccga cccgacgacc      1860
     aggaacagct ccgtcgttag attgactatt ttaattctcg tcgtcgtcac tgccgtactt      1920
     gttctcatgg cggtttacac tctagtccgg gcaagagccg ccggaaaaca actcctcgga      1980
     gaagaaatag attcgtggga agtgacgctt taccaaaaac tcgatttttc aatcgacgac      2040
     attgttaaga atctgacgtc agcaaacgtg atcggaaccg gaagctccgg tgtggtttac      2100
     cgtataacga ttccctccgg cgagtcactc gcggtgaaga aaatgtggtc aaaggaagag      2160
     agtggtgcgt ttaactccga gattaaaact ctaggatcga ttcgtcacag aaacatcgtt      2220
     cgtcttcttg gttggtgctc taatcggaat ctgaaactct tgttctacga ctatctccct      2280
     aacggtagct tgagttctcg gcttcacggc gccggaaaag gaggatgtgt tgattgggag      2340
     gcgcgatacg acgtcgttct tggtgtggcc catgcacttg cttatctcca ccatgattgt      2400
     ctccccacaa ttatacatgg tgacgttaaa gctatgaatg tcttattggg tcctcacttt      2460
     gaaccctact tagctgattt cggtttagct agaaccatct ccggttatcc aaataccgga      2520
     atcgatttag cgaaacccac caatcggcct ccgatggctg gctccttatg gttacatggc      2580
     tccagttttg attttgattt gttttgtttg ttgggtttta cagaacatgc ttcgatgcaa      2640
     cgtattaccg agaagagcga tgtttatagt tacggggtgg tattgttaga ggttttaacc      2700
     ggaaagcatc cgttagatcc ggatctacca ggaggtgcac atttggttaa gtgggtgaga      2760
     gatcacttgg ctgagaaaaa agatcctagc aggcttcttg atccgagact cgatggacgg      2820
     actgactcga taatgcatga gatgcttcaa actcttgcgg ttgcgttctt gtgtgttagc      2880
     aacaaggcaa acgaacgacc tttaatgaaa gatgttgtgg caatgctcac agaaataagg      2940
     catattgatg ttggaagatc ggagacagag aagatcaaag ctggtggttg cggaagcaaa      3000
     gagccacaac aatttatgtc gaatgagaaa atcatcaatt ctcacggttc gtctaattgt      3060
     tcatttgcgt tttcggatga ctccgtttaa                                       3090
//

If you have problems or comments...

PBIL Back to PBIL home page