(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26550

AL161565.AT4G26550   Location/Qualifiers
FT   CDS_pept        complement(join(99930..100040,100413..100517,
FT                   100562..100964,101190..101489,103019..103201,
FT                   103298..103353))
FT                   /gene="AT4g26550"
FT                   /product="putative protein"
FT                   /note="EST DBES:T21637 matches to coord. (3049-3110,
FT                   3207-3389, 3910-3977), EST DBES:AA395643 matches to coord.
FT                   (4367-4444, 4534-4789)"
FT                   /note="similarity to probable membrane protein YBL102w,
FT                   yeast, PIR2:S45393"
FT                   /note="contains EST gb:AI994236.1, T21637"
FT                   /db_xref="GOA:Q944B0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q944B0"
FT                   /protein_id="CAB79510.1"
FT                   /translation="MAMAMEISLPFVGSSMALSAGKSRNSVSRISRVGFSSVSAVHVPR
FT                   RMFMQLSGFGSVLTLLDFPSLAAPVPQMKEPEVISCGVYQKTLKRQRKISDRRRSGLSL
FT                   FAFLEDPETQKMSQGWFSMGGSSTVDQQQQSGSSLLADWNSYAASRDFEESGGSFGFDI
FT                   ESAVRSANDTVSGTFSVCFQESSFVSLIKFLFFCCFCNVPEFDDYRVSKGVRDIPGSLQ
FT                   SATSSMPSGKALMYFGLLLASGVFFIFIAFTMFLPVMVLMPQKFAICFTLGCGFIIGSF
FT                   FALRGPKNQLAHMSSMEVCYTVLLCVCHALNPRRLPSTLGFIATMVGTIYVSMVLHSYI
FT                   LSVLFSVLQVLALVYYCISYFPGGSSGMRFLSSALTSSALRVFGR"
     atggcgatgg ctatggagat ttctcttcct ttcgttggat catccatggc cttaagcgcg        60
     ggaaaatcaa ggaacagcgt ttctaggatt agtcgtgttg gattctcttc ggtctcggct       120
     gtacatgtac ccagaaggat gtttatgcag ctgtctggat ttggttcggt cttgacgctt       180
     ctggattttc ctagtttagc ggcgccggtt cctcagatga aggaacctga agtgatcagc       240
     tgcggcgttt accaaaaaac cttaaaacgt caacgaaaaa tatccgatcg ccggcgttct       300
     ggtctatcat tgtttgcttt ccttgaagat cccgaaaccc aaaaaatgtc acaaggatgg       360
     ttttcgatgg gcgggagtag caccgtagat cagcagcagc aatcgggttc gtctctgctt       420
     gcggattgga attcttacgc agcctctaga gatttcgagg aaagcggcgg aagcttcggc       480
     tttgatatcg aatccgccgt tagatctgcc aatgacactg tttcgggcac cttcagtgtt       540
     tgttttcagg aatcttcttt tgtttctctg ataaaattct tgttcttctg ttgtttttgc       600
     aatgtacctg aatttgatga ctacagggtt tcaaaaggag ttagagatat tccagggagc       660
     ttgcagtcag caacaagtag tatgccttca ggaaaagcgc tcatgtattt cggtttactt       720
     ctcgcaagtg gtgttttctt catcttcatt gccttcacaa tgtttcttcc agtcatggtg       780
     cttatgccac agaaatttgc catttgtttc acccttggat gtggattcat cattggatcc       840
     ttcttcgcac ttcgtggccc taaaaatcag ctcgcacaca tgtcttcgat ggaggtatgt       900
     tacactgttc tattgtgtgt ctgtcatgcc ttaaatccaa gaaggcttcc ttcaacccta       960
     ggtttcattg ctaccatggt tggtaccata tacgtatcaa tggttctcca cagctacatt      1020
     ctctcggtgc tcttctcagt gttacaggtt cttgcgctgg tttactactg tatatcctac      1080
     ttccctggtg gatcatcagg catgaggttc ctcagttctg ctctcacctc atctgcgcta      1140
     agagttttcg ggagataa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page