(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26560

AL161565.AT4G26560   Location/Qualifiers
FT   CDS_pept        complement(join(103908..103965,104069..104181,
FT                   104296..104429,104553..104661,104737..104796,
FT                   104908..104955,105026..105148))
FT                   /gene="AT4g26560"
FT                   /product="putative calcineurin B-like protein"
FT                   /note="strong similarity to calcineurin B-like protein 3
FT                   -Arabidopsis thaliana, PID:g3309086"
FT                   /note="Contains EF-hand calcium-binding domain AA83-95"
FT                   /note="contains EST gb:AI999389.1"
FT                   /db_xref="GOA:Q9SUA6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA6"
FT                   /protein_id="CAB79511.1"
FT                   /translation="MDSTRNSASSNSTGCFTDQKKRKALYEVFKKLSGVDCQRNEGNVV
FT                   EGVTCYYGEMNKEQFHVAIFQTDKNESLFSERVFDLFDTNHDGLLGFEEFARALSVFHP
FT                   SAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASGMSQSDEIVESIIDKTFVQA
FT                   DTKHEGMIDEEEWMDLVFRHPLLLKNMTLQYLKDITTTFPSFVLHSQVEDT"
     atggattcaa caagaaattc agcttcttcc aactccacgg gatgctttac ggatcagaaa        60
     aagcgaaagg cactctatga ggtgtttaag aaactcagcg gtgttgattg ccaaagaaac       120
     gagggtaacg ttgtagaagg cgtaacgtgt tattatggtg aaatgaacaa ggaacagttt       180
     catgtagcca tattccagac tgacaaaaat gagagcttgt tttcagagag ggtcttcgat       240
     ttgttcgaca caaatcatga tggattactt gggtttgagg agtttgcccg agctctctct       300
     gtctttcatc catctgctcc tatagatgat aaaattgacc tttcgtttca gctatatgat       360
     cttaagcagc aaggttttat cgaaaggcag ggggtgaaac aactggtggt ggctactctt       420
     gctgcgtccg gcatgagcca gtcagacgaa atcgtagaga gtataatcga caagacattt       480
     gtgcaagctg acacaaaaca tgaagggatg atcgatgagg aagagtggat ggacctagtt       540
     tttagacatc ctcttcttct gaagaacatg actctccagt atctcaagga tatcacaact       600
     acatttccga gctttgtgtt acactcgcaa gtggaagata cctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page