(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26570

AL161565.AT4G26570   Location/Qualifiers
FT   CDS_pept        complement(join(105783..105840,105938..106050,
FT                   106168..106301,106422..106530,106617..106676,
FT                   106802..106884,107050..107173))
FT                   /gene="AT4g26570"
FT                   /product="calcineurin B-like protein 3"
FT                   /note="contains EST gb:AI999389.1, T21746"
FT                   /db_xref="GOA:Q8LEM7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEM7"
FT                   /protein_id="CAB79512.1"
FT                   /translation="MSQCIDGFKHVCSSFFRCFDIDIYKQSGGLGDPELLARETVFSVS
FT                   EIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGF
FT                   EEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEI
FT                   IESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQ
FT                   VEDT"
     atgtcgcagt gcatagacgg tttcaagcat gtatgctcct cttttttccg gtgttttgat        60
     atcgatattt acaaacaatc tggaggcctt ggtgaccctg aacttcttgc gagagagaca       120
     gtttttagcg tgagtgaaat agaggctctc tatgagctgt ttaagaaaat cagcagtgct       180
     gtgattgatg atgggctaat aaacaaggaa gaatttcagt tagccttgtt caagacaaat       240
     aaaaaagaga gcttgtttgc agaccgggta ttcgatttgt ttgacacaaa gcataatgga       300
     atactggggt ttgaggagtt tgcgcgtgct ctctctgtct ttcatccaaa tgctcccata       360
     gaagacaaga ttgacttttc gtttcagcta tatgatctta agcagcaagg tttcatagag       420
     aggcaagagg tgaagcaaat ggtggtggct actcttgctg agtccggcat gaacctgtca       480
     gacgaaatca tagagagtat aatcgacaag acatttgagg aagctgatac aaaacatgac       540
     gggaggatcg ataaggaaga gtggagaacc cttgttctca ggcatccttc ccttctaaag       600
     aatatgactc tccagtatct taaggatata acaactacat ttccgagctt tgtgttccac       660
     tcgcaggtgg aagatacctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page