(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26580

AL161565.AT4G26580   Location/Qualifiers
FT   CDS_pept        complement(join(108880..109026,109117..109474,
FT                   109562..110133,110177..110242,110471..110609,
FT                   110734..110846))
FT                   /gene="AT4g26580"
FT                   /product="putative protein"
FT                   /note="similarity to RING zinc finger protein - Gallus
FT                   gallus (chicken), PID:e223435"
FT                   /note="contains EST gb:T88029"
FT                   /db_xref="GOA:Q9SUA5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA5"
FT                   /protein_id="CAB79513.1"
FT                   /translation="MEDKLDVLIMGELKLELVELRHYFPSSPLFDSITKLSEGREGERE
FT                   ERWRCLTKKKTRIDKAAAVAVGVLLRRQKTKVVRFYRPTSEDKVFDENASLIYPSMSFF
FT                   LHLKLYSVSLCSCSGDQIKDLSVSDMSTRYSSQLQSSAINSITVSSSSSFASTQLDDNT
FT                   HTAPESSPSSSFFMRLAMRVSRARWFIFLRRVFHYQNASRSDLGTNPFNSIAWMVSELI
FT                   ALLLQITVITSTLALSKNERPVWPMRLWITGYNVGCLLNLMLLYGRYRQQDTSHENAFS
FT                   FGDIEQQQRSREETTRCSHLMNKCRTSLELFFAIWFVIGNVWVFDSRFGSFHYAPILHV
FT                   LCISLLAWNALCYSFPFLLFLLLCCVVPLVSSFLGYNMNVGSSEKGASDDQISSLPSWK
FT                   YKLIDETSDSSQANNDPECCICLAKYKEKEEVRKLPCSHRFHLKCVDQWLRIISCCPLC
FT                   KQDLPN"
     atggaggaca agcttgatgt actcattatg ggagagctca aacttgagct agtagagcta        60
     cgccattatt tcccaagctc acctttgttt gactcgatca caaaactcag tgaagggaga       120
     gagggagaga gggaggagag atggcgttgt ctaaccaaaa aaaaaacgag aatagataaa       180
     gcagcagcgg ttgctgtcgg agttttgctt cgaagacaaa aaactaaggt tgttaggttt       240
     tataggccaa cgagtgaaga taaggtattt gatgaaaatg cctcactgat atatccatcc       300
     atgtcttttt ttttacatct caagctttac tctgtttctc tttgctcttg ttcaggagat       360
     caaatcaaag acctctctgt ttccgatatg agtacccgtt attcctctca gttgcaatca       420
     tcagccatta actccatcac tgtctcctca tcttcttcct tcgcttccac gcaactggat       480
     gataacactc acacggctcc ggagagctct ccatcttctt ccttcttcat gagacttgcc       540
     atgagggtat ctagagcaag gtggttcatt ttcttgagaa gagtctttca ttaccagaac       600
     gcctcaagat ccgatcttgg caccaatcct ttcaattcta tcgcttggat ggtatcagag       660
     ctcatcgctt tacttttaca gatcactgtg ataacatcca cactagcttt gtccaaaaac       720
     gagaggcctg tttggccgat gaggttatgg atcactggct acaacgttgg atgtctgctc       780
     aatcttatgt tactatacgg tcggtatcgt cagcaagata ctagccatga aaatgcattt       840
     agcttcggcg atattgagca gcaacaaaga agcagggaag agaccaccag gtgctcgcat       900
     ttgatgaaca aatgccggac atcgctggag ctattctttg cgatatggtt tgtgataggt       960
     aatgtatggg tttttgattc tcggtttggt tctttccact atgctccaat ccttcatgtc      1020
     ctctgcatct ccctactcgc ttggaacgct ctctgttact ccttcccatt tcttctcttc      1080
     ctcctgctct gttgtgttgt acctctcgtt agtagcttcc tcggctacaa catgaacgtt      1140
     ggatcttcgg aaaaaggagc ttcagatgac cagatctcca gtctcccaag ttggaaatac      1200
     aaactcattg atgaaacttc tgattcttct caagcaaaca atgatccgga atgttgtata      1260
     tgtttggcaa agtacaaaga gaaagaagaa gtgagaaagc ttccatgttc gcataggttt      1320
     cacctcaaat gcgtagatca atggcttcgt atcatctcgt gttgtcctct ttgcaaacaa      1380
     gatctcccta actga                                                       1395
//

If you have problems or comments...

PBIL Back to PBIL home page