(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26590

AL161565.AT4G26590   Location/Qualifiers
FT   CDS_pept        complement(join(111309..112380,112500..113072,
FT                   113142..113239,113322..113773,113959..114025))
FT                   /gene="AT4g26590"
FT                   /product="isp4 like protein"
FT                   /note="strong similarity to isp4 protein
FT                   -Schizosaccharomyces pombe, PIR2:S45495"
FT                   /note="Contains Prenyl group binding site (CAAX box)
FT                   AA750-753;Prokaryotic membrane lipoprotein lipid attachment
FT                   site AA439-449;Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA457-467"
FT                   /note="contains EST gb:AI995580.1"
FT                   /db_xref="GOA:Q9SUA4"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA4"
FT                   /protein_id="CAB79514.1"
FT                   /translation="MVGSLEVSKPPEHKVESKIVIADEEEEDENDSPIEEVRLTVPITD
FT                   DPSLPVLTFRTWFLGMVSCVVLAFVNNFFGYRSNPLTVSSVVAQIITLPLGKLMATTLP
FT                   TTKLRLPGTNWSCSLNPGPFNMKEHVLITIFANTGAGGAYATSILTIVKAFYHRNLNPA
FT                   AAMLLVQTTQLLGYGWAGMFRKYLVDSPYMWWPANLVQVSLFRALHEKEEKREGKQTKL
FT                   RFFLIVFFLSFTYYIVPGYLFPSISYLSFVCWIWTRSVTAQQIGSGLHGLGIGSFGLDW
FT                   STVAGFLGSPLAVPFFAIANSFGGFIIFFYIILPIFYWSNAYEAKKFPFYTSHPFDHTG
FT                   QRYNTTRILNQKTFNIDLPAYESYSKLYLSILFALIYGLSFGTLTATISHVALFDGKFI
FT                   WELWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFVAVLAASFVLALYACEGFGKQLQL
FT                   PWWGLLLACAIAFTFTLPIGVILATTNQRMGLNVISELIIGFLYPGKPLANVAFKTYGS
FT                   VSIAQALYFVGDFKLGHYMKIPPRSMFIVQLVATIVASTVSFGTTWWLLSSVENICNTD
FT                   MLPKSSPWTCPGDVVFYNASIIWGIIGPGRMFTSKGIYPGMNWFFLIGFLAPVPVWFFA
FT                   RKFPEKKWIHQIHIPLIFSGANVMPMAKAVHYWSWFAVGIVFNYYIFRRYKGWWARHNY
FT                   ILSAALDAGTAVMGVLIYFALQNNNISLPDWWGNENTDHCPLANCPTEKGIVAKGCPVF
FT                   "
     atggtaggct ctctcgaagt atccaagcct ccagagcaca aggttgagtc caagatcgtc        60
     atagccgatg aagaagaaga ggatgaaaac gacagtccaa tcgaagaggt ccgtttaacc       120
     gtaccgataa ccgacgatcc atctctacca gttttgacat tccgtacatg gttcttagga       180
     atggtttctt gcgtggtact cgcgttcgtg aacaatttct tcggttaccg gtcgaacccg       240
     ctcacggtat cttcagtcgt ggctcagatc atcactctcc ctctaggaaa gctcatggcc       300
     acgactctac caacaacaaa actccgttta cctggtacaa attggtcgtg ttcgttgaac       360
     cctggaccat tcaacatgaa ggaacatgta ctgatcacta tattcgctaa taccggagct       420
     ggaggagctt atgccaccag catcctaacc atcgttaaag cattttatca ccggaatctc       480
     aatcccgccg ccgccatgtt gcttgtccaa accactcagt tgttgggata tggatgggcg       540
     ggtatgttca ggaaatacct agtggactca ccttacatgt ggtggcctgc aaatcttgtt       600
     caagtctctc tctttagagc cttacatgag aaggaggaga agcgtgaagg aaaacaaacg       660
     aaacttagat tcttcttgat agtcttcttc ctgagcttca cttactacat agtcccaggc       720
     tatcttttcc cttccatctc atatctctcc tttgtctgct ggatatggac ccgctctgta       780
     accgctcaac agatcggttc agggctgcac ggtctcggca ttggctcatt tggtcttgat       840
     tggtccacgg ttgcaggttt cttaggcagt cctttagctg taccgttctt cgctatagcc       900
     aattcctttg gcggatttat catcttcttc tacatcatcc ttcctatctt ctactggagc       960
     aacgcttacg aggcaaagaa gtttcctttc tatacctctc acccatttga tcacactggt      1020
     cagcgttaca acaccactcg tatcctcaac cagaaaacat tcaatattga tcttcctgct      1080
     tacgaaagct atagcaagct ttaccttagc attctgtttg ctctgatcta tgggctcagc      1140
     ttcggtaccc ttaccgcaac catttctcat gtcgccctct ttgacggaaa gtttatctgg      1200
     gagctgtgga agaaggcaac attgacgaca aaggacaagt ttggagatgt gcatacaaga      1260
     ttgatgaaga agaattataa ggaagtacct caatggtggt tcgttgcggt tctcgctgct      1320
     tcctttgtgc tagctcttta tgcatgtgag ggatttggca aacagcttca gctcccatgg      1380
     tggggacttt tactcgcttg tgccatcgcc tttaccttca ctttgcctat tggagttatc      1440
     ctagcgacca caaaccagcg aatgggtctt aatgttatat cggaactgat catcgggttc      1500
     ttgtatccgg gaaagccact tgccaatgtg gcttttaaga cttatggttc tgtgagtata      1560
     gctcaagcct tgtactttgt cggagacttc aaacttggcc actacatgaa gattcctccg      1620
     agatctatgt tcatcgttca actcgttgcg actattgttg cttcaactgt ctccttcggg      1680
     accacatggt ggttgctttc ttcagtcgag aacatctgta acacagatat gctcccaaag      1740
     agtagtccgt ggacttgccc tggggatgta gtgttctaca acgcgtcgat catttgggga      1800
     atcatcggtc ctggaaggat gttcacaagt aaaggtatat accccgggat gaactggttc      1860
     ttcctcattg gcttccttgc tcctgtcccg gtctggttct ttgcaaggaa attcccggag      1920
     aagaagtgga tacatcagat tcatattccc ttgatcttct caggggctaa tgtgatgcca      1980
     atggccaagg ctgtgcatta ctggtcgtgg ttcgctgttg ggatcgtgtt caactactat      2040
     atcttcagga ggtacaaggg atggtgggca aggcataact acatcctctc tgcagctctt      2100
     gatgcaggca ctgcggttat gggagtgttg atctactttg cgttacagaa caataacata      2160
     agcttaccag attggtgggg gaatgagaac acagaccatt gccctttggc aaattgccca      2220
     acagagaaag ggatcgtcgc taagggctgc ccggtgttct aa                         2262
//

If you have problems or comments...

PBIL Back to PBIL home page