(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26600

AL161565.AT4G26600   Location/Qualifiers
FT   CDS_pept        join(116804..117343,117440..117503,117633..117772,
FT                   117875..117958,118050..118124,118214..118285,
FT                   118379..118452,118698..118750,118833..118942,
FT                   119300..119374,119545..119637,119731..119810,
FT                   119898..119988,120103..120432)
FT                   /gene="AT4g26600"
FT                   /product="putative protein"
FT                   /note="similarity to proliferating-cell nucleolar antigen
FT                   P120 -Homo sapiens, PIR2:A48168"
FT                   /note="Contains ATP/GTP-binding site motif A (P-loop)
FT                   AA350-357"
FT                   /note="contains EST gb:T21343"
FT                   /db_xref="GOA:Q9LDL2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023273"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LDL2"
FT                   /protein_id="CAB79515.1"
FT                   /translation="MAALTRNKKKGSNSQTPPLNKQTKASPLKKAAKTQKPPLKKQRKC
FT                   ISEKKPLKKPEVSTDEEEEEEENEQSDEGSESGSDLFSDGDEEGNNDSDDDDDDDDDDD
FT                   DDDEDAEPLAEDFLDGSDNEEVTMGSDLDSDSGGSKLERKSRAIDRKRKKEVQDADDEF
FT                   KMNIKEKPDEFQLPTQKELEEEARRPPDLPSLQMRIREIVRILSNFKDLKPKGDKHERN
FT                   DYVGQLKADLSSYYGYNEFLIGTLIEMFPVVELMELIEAFEKKRPTSIRTNTLKTRRRD
FT                   LADILLNRGVNLDPLSKWSKVGLIVYDSQVPIGATPEYLAGFYMLQSASSFLPVMALAP
FT                   REKERVVDMAAAPGGKTTYVAALMKNTGIIYANEMKVPRLKSLSANLHRMGVTNTIVCN
FT                   YDGREVISKDESVKTSKSADDIKKFAHLQKQLILGAIDLVDANSKTGGYIVYSTCSVMI
FT                   PENEAVIDYALKNRDVKLVPCGLDFGRPGFREHRFHPSLEKTRRFYPHVHNMDGFFVAK
FT                   LKKMSNAMQPSGNDEPAVTMEQAQVSSSDDDDEKAEAIEELEKPPVASGQPKRESNTKE
FT                   DTNKRKNPRSKEIHKGKRNKNTKTESGNVEEPRKQKKKRSQWKNEIAQAR"
     atggctgctc ttacgcgtaa caagaagaag ggttccaatt cacagactcc gccactgaat        60
     aagcagacta aggcgtctcc gctgaagaag gcggctaaaa cccagaagcc tccattgaag       120
     aagcagagga aatgtatttc ggagaagaag cccctcaaaa agcctgaagt ttccacagac       180
     gaggaagaag aagaagaaga gaatgaacag tctgatgaag ggtctgaatc aggttctgat       240
     ttgttctctg atggtgatga agaaggaaac aatgatagtg atgatgatga tgatgatgat       300
     gatgatgatg atgatgatga tgaggatgca gaacccttag ctgaagactt tctcgatggt       360
     agcgataatg aggaggtaac catgggttct gatttggatt ctgactctgg tggatccaaa       420
     ctcgagagga aatctagagc tattgataga aaacgtaaaa aggaggtaca agatgcagac       480
     gatgaattca agatgaacat taaggagaaa cctgatgagt ttcagctacc aacccaaaag       540
     gaacttgaag aagaggcacg tcggccgcca gatcttccta gcttgcaaat gaggataaga       600
     gagattgtta gaatcctgtc gaattttaag gacttgaagc caaaaggaga caagcacgag       660
     aggaatgatt atgttggaca gcttaaagct gatcttagtt cttactacgg ctataatgag       720
     tttcttattg gaactttaat tgagatgttt cctgttgttg aactcatgga actaatcgaa       780
     gcttttgaaa agaaaagacc tacatctata cgtactaaca ctcttaagac tcgaagacgg       840
     gatctggctg atatactttt gaacagagga gttaatctag acccattaag caagtggtca       900
     aaagttggac ttatcgttta tgattcacaa gttccgattg gtgcaactcc tgaatatttg       960
     gcaggattct atatgttgca aagtgctagt tcgttcttgc cagtgatggc ccttgctcct      1020
     cgagaaaaag aacgagttgt ggacatggct gctgcccctg gtggtaaaac aacatatgtt      1080
     gctgcactaa tgaaaaatac aggcataata tatgcaaacg agatgaaagt acctaggctt      1140
     aagtcacttt ctgccaatct acatcgcatg ggagtgacaa ataccatagt ttgtaactat      1200
     gacggacgag aggttatatc aaaagacgaa tcagttaaaa cttccaaaag tgctgatgac      1260
     ataaagaaat ttgcccattt gcaaaagcaa cttatacttg gtgcgattga tttggtagac      1320
     gccaattcca aaaccggtgg atatattgtt tactcaacat gttcagttat gatacccgag      1380
     aacgaagctg tcatcgatta tgctctgaaa aacagggatg ttaaactcgt tccatgtgga      1440
     cttgattttg gccgaccagg ttttagagaa caccggttcc acccttcttt agagaagact      1500
     agacgtttct atcctcacgt gcacaacatg gatggattct ttgttgcaaa gctgaagaag      1560
     atgagcaatg caatgcagcc ttcaggaaat gatgagccag ctgtaacaat ggagcaagct      1620
     caggtgtcgt ctagtgatga tgatgatgag aaagctgagg ccattgagga gttggagaag      1680
     ccacctgttg ccagtgggca acccaagaga gagagtaaca ctaaagaaga cacgaacaaa      1740
     cgaaaaaatc caaggtcaaa ggaaattcac aaaggcaaaa ggaataaaaa cacaaaaacc      1800
     gaaagtggta atgtggaaga acccaggaag caaaagaaga agagatcaca atggaagaat      1860
     gagattgctc aagctaggta a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page