(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26610

AL161565.AT4G26610   Location/Qualifiers
FT   CDS_pept        join(122743..123419,123520..124363)
FT                   /gene="AT4g26610"
FT                   /product="putative protein kinase"
FT                   /note="strong similarity to protein kinase -Arabidopsis
FT                   thaliana, PIR2:JN0505"
FT                   /note="Contains Protein kinases signatures and profile
FT                   AA244-256"
FT                   /note="contains EST gb:AI996119.1, AA042649, H36204,
FT                   AA041115"
FT                   /db_xref="GOA:Q9SUA3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SUA3"
FT                   /protein_id="CAB79516.1"
FT                   /translation="MASKYGSGVLPENKKEKGDKETPETSYSSQSVSVNTLADQVSSTL
FT                   SFAPSSDSKTGGEVKFNEKSDQSGKSNTCRPSTSSDISDESTCSSFSGNNKPHKANDVR
FT                   WEAIQAVRTKHGVLGLNHFRLLKRLGCGDIGTVHLAELHGTRCFFAMKVMDKGALASRK
FT                   KLLRAQTEREILQCLDHPFLPTLYSHFETEKFSCLVMEFCPGGDLHTLRQRQPGKRFSE
FT                   QAAKFYVAEVLLAMEYLHMLGIIYRDLKPENVLVRDDGHVMLSDFDLSLRCTVSPTVVR
FT                   STVLASEGQKNSGYCAQPACIQQPSCISAPTTCFSPRYFSSKSKKDKKMKNETGNQVSP
FT                   LPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLYELLFGKTPFKGS
FT                   GNRATLFNVVGQPLRFPESPVVSFAARDLIRSLLVKEPQHRLAYKRGATEMKQHPFFEG
FT                   VNWALVRCASPPEIPKPVDYESAPATPAAATSTSVKSDQSNYLEFDFF"
     atggcctcga agtatggttc tggagttctc ccagaaaata agaaggaaaa gggcgataag        60
     gaaaccccgg aaacatctta ttccagtcaa agtgtctcag taaacacttt ggcagatcaa       120
     gtatcttcaa ctttgtcttt tgctccaagc agcgacagta aaactggagg tgaagttaaa       180
     tttaatgaaa agtctgatca gagcgggaag agtaacacat gtagaccaag cacaagcagt       240
     gatatcagtg atgagagcac atgtagcagc tttagtggta acaacaagcc tcacaaggcg       300
     aatgacgtga gatgggaagc aattcaagct gtccgaacga aacatggcgt attggggttg       360
     aaccatttta ggctcttgaa gaggttaggg tgtggggata tcggaactgt ccaccttgct       420
     gagttgcacg gaacaaggtg tttttttgca atgaaggtta tggacaaagg ggctttggct       480
     agccgtaaaa agcttcttag agctcagacc gagagggaga tattgcagtg tcttgaccac       540
     ccttttctcc caactttgta tagtcacttc gagactgaga agttctcatg tttggttatg       600
     gagttctgtc ctggaggtga cttgcatacc cttcgacaaa gacagcccgg gaagcgattt       660
     tcagaacaag cagcaaagtt ttatgtagcg gaagtacttc ttgcaatgga atatcttcat       720
     atgcttggca tcatataccg cgatctaaag ccagagaatg ttcttgttag agatgatgga       780
     catgtgatgc tttctgactt cgacctctcc ttgagatgta ctgttagccc cacagtggtc       840
     agatcaactg ttcttgcgtc tgaagggcaa aagaactcgg gttattgtgc gcaacctgct       900
     tgcatccaac agccatcttg catttctgct cctacaacat gcttttctcc acgttatttc       960
     tcaagtaaat ccaagaaaga caagaaaatg aaaaacgaaa ctggaaacca ggtaagtcca      1020
     ttgcccgagc tcgttgctga gcccacaagt gctcgctcaa tgtcatttgt tggcacacat      1080
     gagtatttag ctcctgagat catcaaaggt gaagggcatg ggagtgcggt tgattggtgg      1140
     acttttggga tctttttgta tgagctattg tttggtaaaa ccccgtttaa agggtcagga      1200
     aaccgagcaa cactcttcaa cgttgtgggt cagcctctgc gtttcccaga atctccagtt      1260
     gtcagttttg ctgctaggga tttgattagg agtctgcttg tgaaagagcc tcagcataga      1320
     ttagcgtata agcgtggtgc aactgagatg aagcaacatc ctttctttga aggagtgaat      1380
     tgggcattgg ttcgatgcgc tagcccacca gagataccaa aaccggttga ttatgagagt      1440
     gcgcctgcta ctccagcagc agccacatct actagtgtca agtctgacca gagtaattat      1500
     ctggagttcg atttcttttg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page