(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26620

AL161565.AT4G26620   Location/Qualifiers
FT   CDS_pept        complement(join(124774..125106,125155..125384,
FT                   125783..125985,126093..126178,126675..127052))
FT                   /gene="AT4g26620"
FT                   /product="sucrase-like protein"
FT                   /note="similarity to sucrose cleavage protein - potato,
FT                   Pir2:S51376"
FT                   /note="contains EST gb:F14262"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA2"
FT                   /protein_id="CAB79517.1"
FT                   /translation="MGSGRDRDDPLSFTSNPSTASSPVTVSDYLDNFLGEPTSRSGSFQ
FT                   SESLLGGGGGESINDADFGFARPDFRSEQLAGTVQFYERHVFLCYKKPSVWPARIEAAE
FT                   FDRLPRLLSAAVSARKGSMKKETRLTICEGHDGTETSNGDVLIFPDMIRYRRLTHFDVE
FT                   TFVEEVLVKDGEWLPGNPELLKGSYVFVCSHGSRDRRCGVCGPSLVSRFREELEFHGLQ
FT                   AHQQRRDCRPAMEVRTKFSCSVSFLAVSGLVVIGRFTHDASLIIRGEMGLSEEDQKKTQ
FT                   EGRFQLNGTVHSVKINGKSRAAEPNGCCQQNGNSSSCCQDDTTLMLSLGTSEDNQLESE
FT                   NNTEKLTPGRKIAEKTFFRINSDKGSSTRKVCGIPTWLESWEREDTYAALAVVCAAASV
FT                   AVAYTCYKQL"
     atgggaagtg gaagagatag agacgaccct ttatccttca ccagcaatcc atctacggcg        60
     tcgtctccag tcactgtatc tgactatctc gacaactttc tcggcgaacc cacttctcgc       120
     tccggtagtt ttcaaagcga gagcttactc ggtggaggcg gtggagaaag catcaacgac       180
     gctgattttg gattcgctcg tcctgatttc cgatcggaac aactagctgg aaccgtacag       240
     ttttacgaga ggcatgtctt cttgtgctac aaaaagccat ctgtttggcc cgcaaggatc       300
     gaggctgctg agttcgatcg attgcctagg ctactctctg ctgctgtatc ggccagaaag       360
     ggtagcatga agaaggagac tcgactcaca atatgtgagg ggcatgatgg aacagagaca       420
     tccaatggtg atgtacttat ttttcctgat atgatcagat acaggagatt gactcacttt       480
     gatgtggaga cctttgtgga agaggtgctt gtgaaggatg gtgaatggct gcctggaaat       540
     cctgaattgc tgaaaggctc atatgtcttt gtatgttccc atggatcccg agaccggcga       600
     tgtggggttt gtgggccgtc gctagttagt agattcagag aagaacttga gttccatggt       660
     cttcaagcac atcaacaaag gcgagattgt agaccggcta tggaggtacg tacaaagttt       720
     tcttgttctg tcagttttct cgcagtttcc ggattagtgg taattggtag attcacacat       780
     gatgcttctc tgattattag gggtgaaatg ggtctatcag aagaagatca gaagaaaact       840
     caagaagggc gatttcagct aaatggtaca gtccattccg taaagatcaa tgggaaatca       900
     cgagctgcag aacctaatgg ttgttgccaa caaaatggga acagctcttc atgttgtcaa       960
     gacgacacta ctctgatgtt gtcactggga acatcagaag ataatcaact tgaaagtgaa      1020
     aacaacactg agaagctgac accaggaaga aaaattgcag aaaagacttt ctttagaatt      1080
     aatagtgaca aaggatcttc gacacgtaag gtttgcggaa taccaacatg gttagagagc      1140
     tgggagcgag aagatactta tgctgctctt gctgttgtct gtgctgctgc ttccgtggct      1200
     gttgcctata cttgctacaa acagttgtaa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page