(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26630

AL161565.AT4G26630   Location/Qualifiers
FT   CDS_pept        complement(join(128048..128217,128305..128335,
FT                   128556..128647,128844..129342,129517..129600,
FT                   129683..129775,129975..130085,130165..130224,
FT                   130395..130477,130909..130942,131018..132052))
FT                   /gene="AT4g26630"
FT                   /product="putative protein"
FT                   /note="similarity to various Caenorhabditis elegans
FT                   predicted proteins"
FT                   /note="contains EST gb:AI996874.1, AI994758.1, H76680,
FT                   N38510, W43030, Z18476, AI996256.1"
FT                   /db_xref="GOA:Q9SUA1"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SUA1"
FT                   /protein_id="CAB79518.1"
FT                   /translation="MGEDTKATIEPTANKTTSLEKPSEAMAGKENAGGKETQELAKDED
FT                   MAEPDNMEIDAQIKKDDEKAETEDKESEVKKNEDNAETQKMEEKVEVTKDEGQAEATNM
FT                   DEDADGKKEQTDDGVSVEDTVMKENVESKDNNYAKDDEKETKETDITEADHKKAGKEDI
FT                   QHEADKANGTKDGNTGDIKEEGTLVDEDKGTDMDEKVENGDENKQVENVEGKEKEDKEE
FT                   NKTKEVEAAKAEVDESKVEDEKEGSEDENDNEKVESKDAKEDEKEETNDDKEDEKEESK
FT                   GSKKRGKGTSSGGKVREKNKTEEVKKDAEPRTPFSDRPVRERKSVERLVALIDKDSSKE
FT                   FRVEKGRGAYLKDIPNVANKVMRKRSDETLKLLHPILFGGRRGKAAQIKTNILGFSGFV
FT                   WHGDEKKAKEKVKEKLEKCTKEKLWEFCDVLDIHITKATTKKEDIITKLFEFLEKPHVT
FT                   GDVTGDTTVSEKEKSSKGAKRKRTPKKTSPTAGSSSSKRSAKSQKKSEEATKVVKKSLA
FT                   HSDDESEEEKEEEEKQEEEKAEEKEEKKEEENENGIPDKSEDEAPQPSESEEKDESEEH
FT                   SEEETTKKKRGSRLSAGKKESAGRARNKKAVVAAKSSPPEKITQKRSSAKRKKTDDDSD
FT                   TSPKASSKRKKSENPIKASPAPSKSASKEKPVKRAGKGKDKPSDKVLKNAIVEILKRVD
FT                   FSTATFTDILKELAKEFTEDLTPRKSSIKMIIQEELTKLADEEEEEEKKEEDSEKEEAG
FT                   GSGGGEEVKA"
     atgggggaag atacaaaggc aaccattgag ccaaccgcaa acaagactac ttctcttgaa        60
     aagccatcag aggctatggc tggaaaggag aatgctgggg gtaaggaaac acaagaactg       120
     gcgaaagatg aggatatggc tgagccagac aatatggaga tagatgctca gattaagaaa       180
     gatgatgaaa aagctgagac ggaagataaa gagtcagagg ttaagaaaaa tgaagacaat       240
     gctgagactc aaaaaatgga agagaaggtt gaggtcacca aagatgaggg acaagcagag       300
     gctaccaaca tggatgaaga tgccgatgga aagaaagagc aaactgatga tggtgtttca       360
     gtggaagata ctgtaatgaa ggaaaacgtg gaatctaaag acaataacta tgccaaagat       420
     gatgaaaaag agaccaaaga gacagatatt actgaggcag accacaaaaa agctgggaag       480
     gaggacatac aacatgaagc tgacaaagca aatggaacaa aagatggcaa tacaggagac       540
     atcaaagagg aagggacact ggtagatgaa gacaaaggga cagatatgga tgaaaaagtg       600
     gagaatgggg atgaaaataa acaagtggag aatgttgaag gaaaagaaaa ggaagataag       660
     gaagaaaata aaacaaagga agttgaggcg gcaaaggctg aggtggatga gtcaaaggta       720
     gaagatgaaa aagaagggag tgaggatgag aacgacaatg aaaaagtgga gagcaaagat       780
     gcaaaggaag atgagaaaga ggagacaaat gatgataaag aagatgaaaa agaagagagc       840
     aagggttcta aaaagcgtgg gaaagggacg agttctggag gaaaggttcg cgagaagaat       900
     aaaaccgagg aagtaaaaaa ggatgcagag cctaggactc ctttctctga tcgccctgtg       960
     cgtgagcgga aatctgttga gaggcttgtt gcattgattg ataaagactc ctcgaaagaa      1020
     ttccgtgttg aaaaggggcg aggtgcatat ctcaaagata ttcccaatgt tgctaacaag      1080
     gtaatgagga agaggtctga tgaaactttg aagctgcttc acccaattct atttggtggg      1140
     aggagaggga aggctgctca gatcaagaca aacatattgg gcttctctgg tttcgtttgg      1200
     catggagatg agaagaaagc aaaagaaaaa gtaaaagaaa agcttgagaa atgcaccaaa      1260
     gagaaactgt gggagttttg tgatgtgttg gacatacaca ttaccaaggc tacaacaaag      1320
     aaggaagata ttattacaaa actgtttgag tttttggaga aacctcatgt gacaggtgat      1380
     gtgaccggtg acactacagt ttctgagaaa gagaagtcaa gtaagggagc aaaacgcaag      1440
     agaactccca agaaaacttc acctacagct gggagttcat cctccaaacg atcagcaaag      1500
     agccaaaaaa agtctgaaga agcaacaaaa gttgtcaaaa agagtttagc tcattctgat      1560
     gatgaatctg aagaagagaa agaagaagaa gaaaaacaag aggaggagaa ggcagaagag      1620
     aaagaagaga aaaaagagga ggagaatgaa aatggcattc ctgataaatc tgaggatgag      1680
     gcgcctcagc cttctgaaag cgaggagaaa gatgaatctg aggagcattc tgaagaagaa      1740
     actacaaaga agaaacgtgg ttctagattg tcagctggga agaaagaatc agcagggaga      1800
     gccagaaaca agaaagcagt ggtcgctgca aaatccagtc caccagagaa gattacacag      1860
     aagcggtcat cagccaaacg aaagaagact gatgatgaca gtgatacaag tccaaaggcg      1920
     tcctctaaga ggaagaagtc tgaaaaccct atcaaggcct ccccggctcc ttcaaagtct      1980
     gcatcaaaag agaagccagt aaaaagggct ggaaaaggga aagacaagcc gagtgataaa      2040
     gtgctgaaaa atgcaatcgt tgagatcttg aaaagagtgg actttagtac ggctacgttc      2100
     acggacatcc ttaaagaact tgctaaggag ttcacagaag atctcactcc aagaaagtca      2160
     tctataaaga tgataatcca agaggagctc accaaattag cagatgagga ggaggaggag      2220
     gaaaagaaag aagaggattc agagaaggag gaagcaggag ggtctggtgg tggtgaggag      2280
     gtgaaagcct aa                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page