(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26640

AL161565.AT4G26640   Location/Qualifiers
FT   CDS_pept        complement(join(134473..134944,135209..135364,
FT                   135449..135605,135696..136200,136493..136648,
FT                   136725..136766,137641..137868))
FT                   /gene="AT4g26640"
FT                   /product="putative protein"
FT                   /note="similarity to SPF1 protein -Ipomoea batatas,
FT                   PIR2:S51529"
FT                   /note="contains EST gb:AA585811, AI995443.1, N37131,
FT                   T44598, AI993164.1, F14100, T45479, W43265"
FT                   /db_xref="GOA:Q93WV0"
FT                   /db_xref="InterPro:IPR003657"
FT                   /db_xref="InterPro:IPR036576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q93WV0"
FT                   /protein_id="CAB79519.1"
FT                   /translation="MNPQANDRKEFQGDCSATGDLTAKHDSAGGNGGGGARYKLMSPAK
FT                   LPISRSTDITIPPGLSPTSFLESPVFISNIKKTVFFKTSCLLIDQPEPSPTTGSLFKPR
FT                   PVHISASSSSYTGRGFHQNTFTEQKSSEFEFRPPASNMVYAELGKIRSEPPVHFQGQGH
FT                   GSSHSPSSISDAAGSSSELSRPTPPCQMTPTSSDIPAGSDQEESIQTSQNDSRGSTPSI
FT                   LADDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSHDGQITDIIYKGTHDHP
FT                   KPQPGRRNSGGMAAQEERLDKYPSSTGRDEKGSGVYNLSNPNEQTGNPEVPPISASDDG
FT                   GEAAASNRNKDEPDDDDPFSKRRRMEGAMEITPLVKPIREPRVVVQTLSEVDILDDGYR
FT                   WRKYGQKVVRGNPNPRSYYKCTAHGCPVRKHVERASHDPKAVITTYEGKHDHDVPTSKS
FT                   SSNHEIQPRFRPDETDTISLNLGVGISSDGPNHASNEHQHQNQQLVNQTHPNGVNFRFV
FT                   HASPMSSYYASLNSGMNQYGQRETKNETQNGDISSLNNSSYPYPPNMGRVQSGP"
     atgaaccctc aagctaatga ccggaaggag tttcagggag attgttcggc gacgggagat        60
     ctcacggcaa agcacgattc agctggagga aacggaggtg gaggtgctag gtataagctg       120
     atgtcaccgg ccaagcttcc gatctcgagg tcgactgata tcacgattcc tcctgggttg       180
     agtccgactt cgtttttgga atctcctgtt ttcatctcca acatcaagaa gactgttttt       240
     tttaaaacat catgtttatt gatagatcag ccagaacctt cccctactac tggttctttg       300
     ttcaagcctc gaccagtgca catttctgct agctcaagtt cttatacagg cagggggttc       360
     catcagaaca cctttactga gcagaagtcc agtgaatttg agttcagacc tcctgcatca       420
     aatatggtat atgcagagct tggcaagatt agaagtgagc caccagtaca ttttcaaggc       480
     cagggccatg gatcctcaca ctcaccttct tcgatcagtg atgctgcagg ttcctcaagt       540
     gagctaagcc ggccaactcc tccttgtcag atgacaccaa cgagctcaga tattccggct       600
     ggatctgatc aagaggaatc aatccagact tcccaaaatg actccagagg aagcactcca       660
     tccatcttgg ctgatgatgg ttataactgg agaaaatatg gtcaaaagca tgtcaaaggg       720
     agtgaatttc cccggagcta ttataaatgt acacatccta attgtgaagt gaaaaagtta       780
     tttgaaagat ctcatgatgg gcagatcacc gatattatat acaagggtac acatgaccat       840
     cctaaacctc aacctggtcg ccgaaactct ggtggtatgg ctgcacaaga agaaaggcta       900
     gacaagtatc cttcttcaac tggccgagat gagaagggat ctggcgtcta caacttgtct       960
     aaccccaatg aacaaactgg taaccctgaa gtacctccta tctcagcatc tgacgatggt      1020
     ggagaagcgg cagcgtcaaa taggaataaa gatgagccgg acgatgatga tccattctca      1080
     aaacggagga ggatggaggg tgcgatggaa ataactccac tagtgaaacc catccgggag      1140
     cctcgggttg ttgttcaaac tctgagtgag gttgacattc tggatgatgg ttatagatgg      1200
     cgcaaatatg ggcagaaagt cgtaaggggg aacccaaatc ccaggagcta ctacaaatgc      1260
     acagctcatg gatgcccagt gagaaaacac gtggagagag catcacatga tccaaaagct      1320
     gtaataacaa catacgaagg caaacacgat catgatgttc ccacttcaaa gtctagcagc      1380
     aatcacgaaa tccagcctcg gttcagacca gatgaaacag acaccatcag cctcaatctt      1440
     ggtgttggaa tctcatctga tggacctaac cacgcttcca acgaacatca gcaccagaat      1500
     caacaacttg tcaaccaaac tcacccaaat ggagtcaatt tcaggtttgt tcatgctagt      1560
     cccatgtcat cctactatgc tagcttaaat agcggtatga atcagtacgg ccagagagaa      1620
     acaaagaacg agactcaaaa tggtgacatc tcgtccttga acaattcatc ttacccatat      1680
     ccgcccaaca tggggagagt acaatcgggt ccgtaa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page