(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26650

AL161565.AT4G26650   Location/Qualifiers
FT   CDS_pept        join(142921..143148,143552..144670,144754..144981)
FT                   /gene="AT4g26650"
FT                   /product="hnRNP-like protein"
FT                   /note="several differences to database entry PID:e1169033"
FT                   /note="Contains Eukaryotic putative RNA-binding region
FT                   RNP-1 signature AA49-56;Eukaryotic putative RNA-binding
FT                   region RNP-1 signature AA156-163"
FT                   /note="contains EST gb:T21874, AI995401.1, Z24471"
FT                   /db_xref="GOA:Q9SU99"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034131"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SU99"
FT                   /protein_id="CAB79520.1"
FT                   /translation="MESASDLGKLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTT
FT                   GRARGFGFIVFADPSVAERVIMDKHIIDGRTVEAKKAVPRDDQQVLKRHASPMHLISPS
FT                   HGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITF
FT                   DSEESVDMVLHKTFHELNGKMVEVKRAVPKELSSTTPNRSPLIGYGNNYGVVPNRSSAN
FT                   SYFNSFPPGYNNNNLGSAGRFSPIGSGRNAFSSFGLGLNQELNLNSNFDGNTLGYSRIP
FT                   GNQYFNSASPNRYNSPIGYNRGDSAYNPSNRDLWGNRSDSSGPGWNLGVSVGNNRGNWG
FT                   LSSVVSDNNGYGRSYGAGSGLSGLSFAGNTNGFDGSIGELYRGSSVYSDSTWQQSMPHH
FT                   QSSNELDGLSRSYGFGIDNVGSDPSANASEGYSGNYNVGNRQTHRGTLIDVLKHRKKST
FT                   KRSENCRSRRTAISVAEFEELLFRYQVEKETNFLHHSEFLVLFFSSLASQTQKREVYFY
FT                   FKNSYIR"
     atggaatctg catcggatct gggcaagctc ttcattggcg ggatttcatg ggacacagat        60
     gaagaacgac tgcaagagta ttttggcaag tatggagatt tggttgaagc tgtgatcatg       120
     agagaccgta ctaccggacg tgcccgtggc tttgggttta tcgtttttgc agatccttct       180
     gttgccgaga gagtcatcat ggacaaacac atcattgatg gccgcacggt cgaggcgaag       240
     aaagctgtcc cgcgggatga tcagcaagtg ctaaaacgac acgccagtcc aatgcacctt       300
     atctcaccta gccatggtgg taatggtggt ggagcacgga caaagaagat ctttgttgga       360
     ggtttaccgt ctagcattac tgaggccgag ttcaagaact actttgatca gtttggtaca       420
     attgctgatg ttgtggtaat gtatgatcat aatacacaga ggccaagagg ctttggcttc       480
     atcacttttg attccgaaga gtctgttgat atggttctcc acaagacctt tcatgagcta       540
     aacggaaaaa tggttgaggt taaaagagca gtgccaaagg agctctcctc gactactcct       600
     aaccgaagcc cacttattgg gtatggtaac aactatggag tagtccctaa taggtcttct       660
     gctaatagct acttcaatag ttttcctcct ggttataata ataataatct aggctctgct       720
     ggccggttta gtcctattgg tagcggtaga aatgctttct ctagcttcgg gctcggattg       780
     aatcaagaac tgaatttgaa ttcaaacttt gatggaaaca ctcttgggta tagccggatc       840
     cctggcaacc aatacttcaa cagtgcttca ccaaaccgtt acaactctcc aattgggtac       900
     aacagaggag actctgctta caacccgagc aacagagact tgtggggaaa cagaagcgat       960
     tcctctggtc caggttggaa cttgggagtt tcggttggta acaacagagg aaactgggga      1020
     ctttcttctg tggtgagcga taacaatggc tatggaagaa gctatggggc tggttctgga      1080
     ctttcggggt tatcattcgc gggtaataca aacggttttg atggctctat aggggaattg      1140
     tatagaggca gctcagttta tagcgactca acatggcagc agtcaatgcc tcatcatcag      1200
     tcttctaatg agttagacgg cttgtctcgc tcttatggct ttggtattga caatgtaggc      1260
     tcagacccat cagccaatgc ctcagaagga tactccggaa actacaatgt cggaaataga      1320
     caaacacata gaggtacact catcgatgta ttgaagcata gaaagaaatc gacgaagaga      1380
     agtgagaatt gtagatcaag aagaacagcc atttccgttg cagagtttga agagttgtta      1440
     tttcgatatc aagtagagaa agaaaccaac tttcttcatc acagtgagtt tcttgttttg      1500
     tttttttcgt cgttagcatc acaaacacaa aaaagagaag tttattttta ctttaaaaat      1560
     tcttacataa gataa                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page