(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26660

AL161565.AT4G26660   Location/Qualifiers
FT   CDS_pept        join(145929..146186,146310..146480,146599..147456,
FT                   147555..147641,147849..148616,148711..148989)
FT                   /gene="AT4g26660"
FT                   /product="putative protein"
FT                   /note="similarity to probable kinesin - Arabidopsis
FT                   thaliana, Pir2:H71402"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA219-229"
FT                   /note="contains EST gb:AI998850.1"
FT                   /db_xref="GOA:Q9SU98"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SU98"
FT                   /protein_id="CAB79521.1"
FT                   /translation="MKSPAILSENRFLGSITSSSIRNLLPKSISGKQKPIIQNPDTKIP
FT                   RSNDENAIPVDPNQKASDHHTALQFTKQSDSKDGNFGEPIKDNKMGQSTFAEDKRSLLD
FT                   SPLKVESRSILSRRTNSVPSEIKEEDDDDSLGDQIRELKEELIRTKSDGYNKADASKSG
FT                   HFARDSLSQLRVSINKSLLMSCPKRDESEGKEVIVDGEDVLELNKHIEKLHGSYDSVHS
FT                   SFASASCYEADSMSGDDEDVCSEDLEKPMHGNHKDVDFVDNDPSQLDNVEFDTTGSGIS
FT                   IRSQLPSCVLEEPIFSESPKFKNVQKSVAASTKFSANPRNVSESSNIGDMKVNQISPCM
FT                   SKKVSGPTDSLAASLQRGLQIIDYHQGSSLSKSSSVSFSFGHMALKPCAEGENLNASVQ
FT                   SFRKDKASEGGLSSILLCLSCRKKVDQEAEVTEEAGSNEKHLKNMCMEQAAKIEELTLL
FT                   LRKSDDGEDGTEFIKETYETKQISEEFGKTNFEVSEKEALLKEIADLKSKLQPTKSTDN
FT                   LRSSLLLRSIQMRKSIDVSRNGENSDDLAKEREMWTEMESEWISLTDDLRMDIDNHRSR
FT                   AENLEFELKQEKLATEELNDALTRAVLGHSRFIEQYTELQETYNELGEKHSVMMAGITD
FT                   VKKAASKAAMNGRHGKRFAKAFSDELSAIRAEKEKERELLKKENKNLRTQLRDTAEAVQ
FT                   AAGELLVRLRESEQALQVSEERFSVVEEEKERLKKQMEQLKSKHKTEIGTMKQYLAESK
FT                   LPGSALLQPWYKDEEDEIEQVSEHETGAVSFDDYEDDQAWRAEFGATYQDHHY"
     atgaagtctc cggcgatatt aagcgagaac aggttcctag gcagcattac aagttcttcc        60
     atccgaaatc tgcttccaaa atctatctca gggaagcaga aaccaatcat ccaaaaccca       120
     gatactaaga ttcccagatc caacgacgag aacgcgattc ctgtagatcc aaaccaaaag       180
     gctagcgatc atcacaccgc tcttcagttc acgaagcaat ctgactcaaa ggatggtaat       240
     ttcggagagc caattaagga caataaaatg ggacaaagca cttttgctga agacaagcgc       300
     agtcttctgg attcaccatt aaaggttgaa tcaaggagta tactttctag aagaaccaat       360
     tcagtgccta gtgaaattaa agaggaagat gacgacgact cattgggtga tcagattcgt       420
     gaactaaagg aagagctcat aagaacaaag tcggatgggt acaacaaagc tgatgcaagt       480
     aagagtggac actttgcacg tgacagttta agtcaattga gagtcagtat caacaaatct       540
     ttactcatgt cgtgtccaaa aagagatgaa tctgagggaa aagaggtgat cgtggatggt       600
     gaagatgtgc tggaattgaa taaacatatt gagaagcttc acggttctta tgattctgtt       660
     cactcctcat ttgcaagtgc ttcatgctat gaagccgact cgatgagtgg agatgatgag       720
     gatgtctgct cagaagactt ggagaaacca atgcatggaa accataaaga tgttgacttt       780
     gtagataatg atccaagcca gctcgacaat gttgaattcg atacaacggg tagtggcatt       840
     tcaatcagat cacagcttcc tagttgcgtt ctagaagagc caattttctc agaatctcca       900
     aagtttaaga atgttcagaa gagtgtagct gcatcgacaa agttttcagc aaatcctagg       960
     aatgtgtctg aaagctccaa cattggagac atgaaagtca atcagattag cccgtgtatg      1020
     tcaaagaagg tttcaggtcc tacagattct ctagctgcta gtcttcagag agggctgcaa      1080
     attatagact atcaccaagg gagctcacta tcaaaaagtt catctgtttc cttctctttt      1140
     ggccatatgg cattgaaacc ttgcgcagaa ggtgagaatc ttaatgcttc agtccaatct      1200
     tttagaaaag ataaagcttc agaaggtgga ttgtcgtcga ttctcctatg tctttcatgt      1260
     agaaagaaag ttgaccaaga agctgaagta acagaagaag ctggttcaaa cgaaaaacat      1320
     ctcaagaaca tgtgtatgga gcaagcagct aaaattgagg agctaactct cctgcttagg      1380
     aaatcagatg atggagaaga tggaacagag ttcatcaaag aaacatatga gacgaaacaa      1440
     attagtgaag agtttggaaa aacaaacttt gaggtaagtg aaaaggaagc tcttctcaag      1500
     gagattgcag acctaaagag caagctgcag cctactaagt ccacagacaa tctgagatcc      1560
     tcgttactac tacgatccat tcaaatgcgc aaaagcattg atgttagcag gaatggtgag      1620
     aacagtgatg atctagcgaa agaaagggag atgtggacag aaatggagag tgagtggata      1680
     tccttaacag atgatctcag aatggatatc gataaccatc gcagtcgagc tgagaatcta      1740
     gagtttgagc tcaagcaaga gaagctagcc actgaagagt tgaatgacgc gctcactaga      1800
     gctgtgcttg gccacagtag attcatagag cagtacacag agctgcagga gacgtacaat      1860
     gaacttgggg agaagcacag tgtgatgatg gctggaataa cagatgtaaa gaaagcagca      1920
     tccaaggccg ctatgaacgg ccgccatgga aagcgttttg ccaaagcctt ttcagatgag      1980
     ctttctgcca tcagagctga gaaagagaaa gaaagagagc tcttgaagaa ggagaacaag      2040
     aacctaagaa ctcagctgcg agatacagct gaagcagtcc aagctgctgg tgaactactt      2100
     gtcagactta gagaatctga acaggcctta caagtctctg aggaacgatt cagcgtggtg      2160
     gaagaagaga aagagaggct gaagaagcaa atggagcaac taaagagcaa acacaagaca      2220
     gaaataggga caatgaagca atacttagca gagagtaaat taccaggatc tgcattgttg      2280
     cagccatggt acaaagatga ggaagatgaa atagaacaag tatcagaaca tgaaaccgga      2340
     gctgtcagtt tcgatgacta cgaggatgat caggcttgga gagcagagtt tggagctaca      2400
     tatcaagacc accattacta g                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page