(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26670

AL161565.AT4G26670   Location/Qualifiers
FT   CDS_pept        join(149432..149633,150029..150087,150168..150240,
FT                   150342..150395,150516..150754)
FT                   /gene="AT4g26670"
FT                   /product="putative protein"
FT                   /note="weak similarity to probable membrane protein YDL217c
FT                   - yeast, EMBL:Z74265"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA129-139"
FT                   /note="contains EST gb:AA404844, T46407"
FT                   /db_xref="GOA:Q94EH2"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94EH2"
FT                   /protein_id="CAB79522.1"
FT                   /translation="MAANDSSNAIDIDGNLDSDSNLNTDGDEATDNDSSKALVTIPAPA
FT                   VCLFRFAGDAAGGAVMGSIFGYGLFKKKGFKGSFADAGQSAKTFAVLSGVHSLVVCLLK
FT                   QIRGKDDAINVGVAGCCTGLALSFPGAPQALLQSCLTFGAFSFILEGLNKRQTALAHSV
FT                   SLRHQTGLFQDHHRALPLSLALPIPEEIKGAFSSFCKSLAKPRKF"
     atggcggcga acgattcttc aaatgctatt gacatcgacg ggaatctcga ctccgattcg        60
     aatcttaaca ctgacggtga cgaagcgacc gataatgatt cctcgaaggc attggttact       120
     atccctgctc cagccgtttg tcttttccgg ttcgccggag atgctgctgg tggcgccgtt       180
     atgggctcta tcttcggata tggattgttc aagaagaaag gcttcaaagg atcatttgca       240
     gatgcagggc agtctgctaa gacttttgct gttttatctg gagtccacag tttggttgtt       300
     tgccttctga agcaaatccg aggcaaagat gacgccatta atgttggagt agcagggtgt       360
     tgcactggtc ttgctcttag tttccctggt gctccacagg ctcttctaca gagttgtctc       420
     acgtttgggg cattctcttt tattcttgag ggactcaaca aaagacaaac agctttggca       480
     cactcggtct cgttgagaca ccaaaccgga ctgttccaag atcatcatcg tgctttacca       540
     ctctctcttg ctctcccgat ccctgaagaa atcaaaggag ccttttcttc tttctgcaag       600
     tccttagcta aaccaaggaa gttctaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page