(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26680

AL161565.AT4G26680   Location/Qualifiers
FT   CDS_pept        152028..153593
FT                   /gene="AT4g26680"
FT                   /product="putative protein"
FT                   /note="similarity to other putative proteins from
FT                   Arabidopsis"
FT                   /note="contains EST gb:AA395033, Z34229"
FT                   /db_xref="GOA:Q9SZ10"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ10"
FT                   /protein_id="CAB79523.1"
FT                   /translation="MIRISIGVNRRLRYQFSSFAGYSGSENPRLFKTLGAANTPIPHRR
FT                   NPEPKGQDLDFVNVAHSHLIQSDWDKLNKLSDHLDSFRVKNVLLKIQKDYLLSLEFFNW
FT                   AKTRNPGSHSLETHAIVLHTLTKNRKFKSAESILRDVLVNGGVDLPAKVFDALLYSYRE
FT                   CDSTPRVFDSLFKTFAHLKKFRNATDTFMQMKDYGFLPTVESCNAYMSSLLGQGRVDIA
FT                   LRFYREMRRCKISPNPYTLNMVMSGYCRSGKLDKGIELLQDMERLGFRATDVSYNTLIA
FT                   GHCEKGLLSSALKLKNMMGKSGLQPNVVTFNTLIHGFCRAMKLQEASKVFGEMKAVNVA
FT                   PNTVTYNTLINGYSQQGDHEMAFRFYEDMVCNGIQRDILTYNALIFGLCKQAKTRKAAQ
FT                   FVKELDKENLVPNSSTFSALIMGQCVRKNADRGFELYKSMIRSGCHPNEQTFNMLVSAF
FT                   CRNEDFDGASQVLREMVRRSIPLDSRTVHQVCNGLKHQGKDQLVKKLLQEMEGKKFLQE
FT                   SFNN"
     atgattcgca taagcatcgg agttaatcgc cgtctgcgtt atcaattctc aagttttgct        60
     ggctacagtg gatctgaaaa ccctaggctc tttaaaactc tcggcgctgc aaacaccccg       120
     attcctcaca gaaggaatcc tgaacctaaa ggccaagatc ttgatttcgt caatgttgct       180
     catagccacc tgattcaatc tgattgggat aagctaaata agctatcaga ccacttggat       240
     tcatttaggg tcaagaacgt attactgaag atacagaaag attatcttct ttctcttgaa       300
     ttcttcaatt gggcgaaaac ccgaaaccca ggttctcact ctcttgaaac ccatgctata       360
     gttcttcaca ctctcactaa aaaccgcaag ttcaagtctg cagagtccat tttgagagat       420
     gtacttgtaa atggtggtgt ggatttgcct gccaaagtat ttgatgcttt gttgtattcg       480
     taccgggaat gtgattctac gcctagagtg tttgattcac tcttcaaaac ttttgctcat       540
     ttgaagaaat tcagaaatgc tacagatact tttatgcaga tgaaggatta tgggtttctt       600
     ccaactgttg aatcttgcaa tgcttacatg agttcattac ttggtcaagg gagggtggat       660
     attgctttga ggttttacag agaaatgcgg cggtgtaaga tatctccaaa cccatacact       720
     ctcaacatgg taatgtcagg ttattgtagg tctggaaaac ttgacaaggg cattgagtta       780
     ctacaagaca tggaaagatt gggttttcgg gctacagatg tgtcgtataa tactttgata       840
     gccggacatt gcgaaaaggg tcttttgagc tcagctttga agcttaagaa catgatggga       900
     aagagtggtc tgcagcctaa tgtggttact tttaacactc tcatccatgg gttttgcaga       960
     gctatgaagt tacaagaagc tagtaaggtt ttcggtgaga tgaaagcggt caacgtggct      1020
     cccaacactg tcacgtataa cacgttgatt aatgggtaca gccaacaggg tgatcacgaa      1080
     atggcgttcc ggttttatga agatatggtc tgcaacggga ttcaacgtga cattttgacg      1140
     tacaacgcgt tgatatttgg actatgcaaa caagctaaga cgaggaaagc tgcacagttt      1200
     gttaaagaac tcgacaaaga gaatttggtg ccaaactcgt caaccttttc tgcgctaata      1260
     atgggacaat gcgtgaggaa aaatgcagac cgtggttttg aactgtacaa aagcatgatt      1320
     aggagtggtt gccatccgaa tgaacaaaca ttcaacatgc tggtttctgc cttctgtagg      1380
     aatgaggatt ttgatggagc atctcaagtg ctaagggaaa tggtcagaag atcaattcct      1440
     cttgattcaa ggactgttca tcaggtctgc aatggactta agcatcaagg gaaagaccaa      1500
     cttgtgaaaa agttgttaca ggagatggaa gggaaaaagt ttctacaaga atcttttaat      1560
     aactga                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page