(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26690

AL161565.AT4G26690   Location/Qualifiers
FT   CDS_pept        complement(join(153968..154263,154346..154829,
FT                   154930..155072,155273..155557,155650..155688,
FT                   155784..156401,156477..156770,156945..157076,
FT                   157710..157731))
FT                   /gene="AT4g26690"
FT                   /product="putative protein"
FT                   /note="weak similarity to hypothetical protein PFB0835c -
FT                   malaria, PID:g3845289"
FT                   /note="contains EST gb:AI994396.1, T42321, R65259,
FT                   AA720169, R64793"
FT                   /db_xref="GOA:Q9SZ11"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ11"
FT                   /protein_id="CAB79524.1"
FT                   /translation="MNANACKDNPTMRGLLRASSLLLCGVILIQLLAAQIHAQSKKPKS
FT                   PWPTLTGDPPLVIARGGFSGLFPDSSYDAYNFAILTSVPDAVLWCDVQLTKDALGICFP
FT                   DLTMRNSSSIEAVYPTRQKSYPVNGVPTSGWFTIDFSLKDLKDVNLIRGILSRSEKFDG
FT                   NSNPIMTVQSVSTQMKPSFFWLNVQHDAFYAQHNLSMSSFLVAASKTVLIDFISSPEVN
FT                   FFKKIAGRFGRNGPSLVFRFLGQDEFEPTTNRTYGSILSNLTFVKTFASGILVPKSYIL
FT                   PLDDQQYLLPHTSLVQDAHKAGLEVFVSGFANDIDIAHDYSFDPVSEYLSFVDNGNFSV
FT                   DGVLSDFPITASASLDCFSHVGRNATKQVDFLVITKDGASGDYPGCTDLAYKKAIKDGA
FT                   DVIDCSVQLSSDGTPFCLSSIDLGNSTTVSLTAFRNRSTTVPELGSLGAIYTFSLTWAE
FT                   IQTLTPAISNPYRVTSLFRNPKQKNAGKLFSLSDFLSLAKNSTSLSGVLISVENAAYLR
FT                   EEQGLDVVKAVLDTLTQTGYSNSTATKVMIQSTNSSVLVDFKKQSQYETVYKVEENIRD
FT                   ILDSAIEDIKKFADAVVIQKLSVFPVAQSFITTQTNVVEKLQKSQLPVYVELFQNEFLS
FT                   QPYDFFADATVEINSYITGAGINGTITEFPFTAARYKRNLCLGRKETIPYMAPAQPGAL
FT                   LTLVSPTAFPPAEAPNPVFTDADVTEPPLPPVTAKAPTSSPGTPSTNAQAPSGQTRITL
FT                   SLLLSVFAMVLASLLLL"
     atgaatgcca atgcatgcaa agacaatcca acaatgcgag ggttattacg agcttcatcg        60
     cttcttctct gtggtgttat tctgattcag ctgcttgctg ctcaaatcca tgctcaaagt       120
     aaaaaaccta aaagtccatg gccaacgctc actggtgatc ctcctcttgt gatagctcgt       180
     ggtggattct ctggattgtt cccagattcg agttacgatg cttacaattt cgcaattctg       240
     acaagtgtac cagatgctgt tctatggtgt gatgttcagc taaccaaaga tgctcttggt       300
     atttgcttcc ctgatttaac aatgagaaat tcttcatcta ttgaagctgt ttaccctact       360
     cgacaaaaat cttacccggt taacggagtt cctacttccg gttggttcac cattgatttc       420
     tccttgaaag atctcaaaga tgttaacttg atccgaggta ttttatctcg gtcagaaaag       480
     ttcgatggta attctaaccc gattatgacg gttcaaagcg tatccacgca gatgaaacca       540
     tcattcttct ggttaaatgt tcagcacgat gcgttctacg cgcagcacaa tttgagcatg       600
     agcagttttc tggttgcagc ttcaaaaact gttctcattg acttcatctc ttcccctgaa       660
     gtgaacttct ttaagaaaat tgctggtcgg ttcgggcgta atggaccaag tcttgtgttc       720
     cggtttcttg gtcaagacga gttcgagcca acgacaaaca gaacttacgg ctctatcttg       780
     agtaacttga cttttgtcaa gacgtttgct tcagggattc ttgtccccaa gtcttacata       840
     ttgccacttg atgaccagca gtacttgctt cctcatacat ccttggttca agatgctcac       900
     aaagcaggat tagaagtttt tgtgtcaggt tttgcaaatg atattgatat tgcacacgac       960
     tacagtttcg atccagtctc tgagtatcta tcttttgtgg acaatggcaa cttctctgtt      1020
     gatggtgtgc tctctgattt tcccataact gcatctgcat cccttgattg cttctcccac      1080
     gttggcagaa acgctacaaa acaagtggat tttcttgtta taaccaaaga tggtgcgagt      1140
     ggagactatc ctggatgtac agacttggca tataagaagg caatcaaaga tggtgctgat      1200
     gtaatcgatt gctcggtcca attgtccagc gatggtacac ccttttgctt aagttcgatc      1260
     gatctcggga acagcacgac ggtctcccta actgctttca gaaaccgttc aacaactgtt      1320
     cctgagttgg gctcacttgg tgcaatatac actttcagtc tcacatgggc tgagatccag      1380
     accttgactc ctgctatttc aaacccctac agagtaacca gcctgtttag gaatccaaaa      1440
     cagaaaaatg ctgggaagct tttctcactt tctgatttcc taagcttggc aaaaaactcc      1500
     acctctctct ccggtgtttt gatcagtgta gagaatgcgg catacctgag agaggagcaa      1560
     gggctcgacg ttgtcaaagc ggttcttgat acactcacac agactggcta cagcaatagt      1620
     acagccacaa aggtcatgat tcagtcaaca aacagctcgg ttctagttga cttcaagaag      1680
     cagagccagt acgagactgt ctacaaagtt gaagaaaaca tccgtgatat tctcgactct      1740
     gctattgaag acataaagaa attcgctgat gctgttgtga tccaaaaatt atcagtcttt      1800
     cctgtcgctc agtcgttcat cacaacgcaa accaatgttg tggagaagct gcagaagtct      1860
     cagctcccag tttatgtgga actgtttcag aatgagtttt tatctcaacc atatgacttc      1920
     tttgctgatg caaccgttga gataaactct tatatcactg gagccggtat aaatggaacc      1980
     atcaccgagt tcccttttac agctgcaaga tacaaaagga atctatgttt gggcagaaaa      2040
     gaaactatac cttacatggc ccctgcccaa cccggtgccc tcttaaccct tgtgagtcct      2100
     actgcctttc ctccagccga agctccaaac ccggttttca cagatgctga tgtcactgag      2160
     ccaccactac ctccggttac cgcaaaagcc ccaacctcat cccctggaac cccatcaacc      2220
     aatgcacaag cacctagtgg acaaacccga atcactctat ctcttctact ttctgttttc      2280
     gcaatggttc ttgcctctct tctacttctg tga                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page